DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG32277

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:242 Identity:77/242 - (31%)
Similarity:119/242 - (49%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 FEENNRNALKFLCGGSLIHSRYVITSAHCINPMLTLVRLGAHDLSQPAESGAM--DL---RIRRT 407
            |..|.|...||.|||.:|....|:|:|||:......||    ||:..|:...:  |:   .:|..
  Fly    40 FLVNLRRGGKFRCGGVIISPNCVLTAAHCLEGRYQQVR----DLTVHAQQQCLGDDMPPEHVRSA 100

  Fly   408 ----VVHEHFDLNSISNDIALIELNVVGALPGNISPICLPEAAKFMQQDFVGMNPF----VAGWG 464
                :...:.....:.:|:|:|.|:....:.||         |..::.|:..:.|.    |.|||
  Fly   101 WYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGN---------ASLVKIDYNDLPPHSNLTVLGWG 156

  Fly   465 AVKHQGVT-SQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCA-GSSSVDACQGDSGGPLMM 527
            |:..||.. :|.|::|.|.::|...|.:|..|.:|.|  ::.:.|| |.::.||||||||||.  
  Fly   157 AINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKV--TNNMFCALGKNARDACQGDSGGPA-- 217

  Fly   528 PQLEGNVYRFYLLGLVSFGYECARPNFPGVYTRVA--SYVPWIKKHI 572
                  :|....:|:||:||.|. ..:||||||::  |...|:|..|
  Fly   218 ------IYAGRSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 74/236 (31%)
Tryp_SPc 328..571 CDD:238113 76/239 (32%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 73/229 (32%)
Tryp_SPc 27..246 CDD:238113 73/229 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468956
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.