DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG4927

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:399 Identity:101/399 - (25%)
Similarity:151/399 - (37%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GSC--LPLTSCPQLMQEYQGQANEFHTFLGQSICGF-DGSTFMVCCATDRSGNARSRKDVFVTTA 263
            |.|  |..|.||.:.         |:..|.::...: |.|..:|||....:...:|::     .:
  Fly    27 GECKELSATDCPSIF---------FNLHLIRNFVKYCDKSNHIVCCLLPNNMQPQSQQ-----FS 77

  Fly   264 APFGFFHFSPLSGGSTATPMVFQPTPPLSQVVSPSFYPPPPPPPPNNAPRESATCGISGATSNRV 328
            |..|...|                                     ....|.......|..|:..:
  Fly    78 ANIGLRRF-------------------------------------EKECRRFNEIRTSCRTTPFI 105

  Fly   329 VGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCINPMLT----------- 382
            |||.:|....:|::|.||. ...|.:.:.:.||..:||.::|:|:|||:....|           
  Fly   106 VGGAKAAGREFPFMALLGQ-RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDG 169

  Fly   383 ---LVRLGAHDLSQPAESG-AMDLRIRRTVVH----EHFDLNSISNDIALIELNVVGALPGNISP 439
               :||||..|.:...:.. ..|.|:...|||    |..|..|..||||::||.:.......::|
  Fly   170 PKYVVRLGELDYNSTTDDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAP 234

  Fly   440 ICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSD 504
            .|||......|     :....|||||....|..|..|....:.......|.|         :...
  Fly   235 ACLPLDGGNEQ-----LQVAAAGWGATSESGHASSHLLKVSLDRYDVAECSQ---------RLEH 285

  Fly   505 KV-----LCAG--SSSVDACQGDSGGPLMMPQLEGNVYRF--YLLGLVSFGYECARPNFPGVYTR 560
            |:     ||||  |:|.|.|.||||||:.   ::..:|..  .::|:.|:|..|.....|.|||:
  Fly   286 KIDVRTQLCAGSRSTSADTCYGDSGGPVF---VQHPIYSCLKQVIGITSYGLVCGVQGLPSVYTK 347

  Fly   561 VASYVPWIK 569
            |..|..||:
  Fly   348 VHLYTDWIE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855 11/44 (25%)
Tryp_SPc 327..568 CDD:214473 79/268 (29%)
Tryp_SPc 328..571 CDD:238113 81/270 (30%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 81/270 (30%)
Tryp_SPc 105..355 CDD:214473 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.