DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG14760

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:354 Identity:93/354 - (26%)
Similarity:138/354 - (38%) Gaps:93/354 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 RSGNARSRKDVFVT----TAAPFGFFHFSPLSGGSTATPMV--FQPT-----PPLSQVVSPS--- 298
            ||.:..|.|...:.    ||||      ||..||...:.:|  ||||     ..:.::.||:   
  Fly   224 RSSSKTSAKRARIVSSYPTAAP------SPGHGGGRFSCLVEAFQPTCSCGWSRIPRIASPTNEE 282

  Fly   299 ----FYPPPPPPPPNNAPRESATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFL 359
                .:||                         :.|.:..:.|                   |..
  Fly   283 AVLHEFPP-------------------------MAGVLTKKHG-------------------KVF 303

  Fly   360 CGGSLIHSRYVITSAHCI-----NPMLTL-VRLGAHDLSQPAESGAMD-LRIRRTVVHEHFDLNS 417
            ||.::||.||::::|||.     |....| |.:|.|||:...|:.|.. ..:...::||.|...|
  Fly   304 CGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDLASSFETFATQRYDLDALILHEDFSQAS 368

  Fly   418 --ISNDIALIELNVVGALPGNISPICLP-----EAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQV 475
              ..||||:::..:......::.|.|||     :..|.   ...|.....||||...:.|..:..
  Fly   369 GQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGEDGQKL---PLAGHQVVAAGWGTTSYGGPQTHR 430

  Fly   476 LRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYLL 540
            |..|.:.::....|.|:..|.   ........|..:...|.||.||||.| ..::.|   |...:
  Fly   431 LLKATLDVIDGRRCRQALSSA---GGLPPHTFCTYTPGRDTCQYDSGGAL-YERING---RLMAV 488

  Fly   541 GLVSFGYECARPNFPGVYTRVASYVPWIK 569
            |:||||..||... |.|.|||||::.||:
  Fly   489 GIVSFGQACAAQQ-PSVNTRVASFIKWIR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 70/254 (28%)
Tryp_SPc 328..571 CDD:238113 72/256 (28%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 73/289 (25%)
Tryp_SPc 281..515 CDD:214473 72/288 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456028
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.