DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CG18477

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:127/270 - (47%) Gaps:21/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 NAPRESATCGI---SGAT-SNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYV 370
            |.|.....||.   .|.| |.|......|::...||:.||     .:.....::.||:||....|
  Fly    85 NEPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVAL-----LDARTSSYVAGGALIAPHVV 144

  Fly   371 ITSAHCINPMLT---LVRLGAHDLSQPAES-GAMDLRIRRTVVHEHFDLNSISNDIALIELNVVG 431
            ||:......|..   :||.|..|.|...|. .::|:.||..|.|..|:|.:.:|::||:.|....
  Fly   145 ITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSL 209

  Fly   432 ALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVT-SQVLRDAQVPIVSRHSCEQSYKS 495
            ....:|:|||:|.|.|    :|........|||.......: ..||:...:|:|.|.:|||..:.
  Fly   210 TSSRHINPICMPSAPK----NFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRL 270

  Fly   496 IF-QFVQFSDKVLCAGSS-SVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVY 558
            .: ...:..:.::|||.. ..|:|:||.|.||.. .::.|..|:.|.|:|:||.:|..|..|.||
  Fly   271 YYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLAC-AIKDNPQRYELAGIVNFGVDCGLPGVPAVY 334

  Fly   559 TRVASYVPWI 568
            |.||:.:.||
  Fly   335 TNVANVIEWI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 75/247 (30%)
Tryp_SPc 328..571 CDD:238113 76/248 (31%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 74/240 (31%)
Tryp_SPc 113..344 CDD:238113 74/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.