DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and l(2)k05911

DIOPT Version :10

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:73 Identity:18/73 - (24%)
Similarity:35/73 - (47%) Gaps:12/73 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LKEIGRRTKGYRLCNMLEGGRTPLHT-PDELKEMGFHLIAHPLTSLYAST----RALVD----VL 287
            ::|..:..|...:|:.:.|  ..:.| |.:||...:::..| :|..:.||    |..:|    ::
  Fly     4 VEEFRKLMKSLIVCSKVAG--VEMWTAPGKLKPASYYVSFH-ITVYFVSTVWTLRKYIDDPIHMM 65

  Fly   288 KILKEKGT 295
            |:|...||
  Fly    66 KVLITMGT 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:463440 2/11 (18%)
Tryp_SPc 328..571 CDD:238113
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
PTZ00449 <198..>376 CDD:185628
Tryp_SPc 400..637 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.