DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and Prss34

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:137/278 - (49%) Gaps:64/278 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 VVGGMEARKGAYPWIAALGYFE-ENNRNALKFLCGGSLIHSRYVITSAHCINP----------ML 381
            :|||.......:||..:|..:: |::|  .:..|||||||.::|:|:|||:.|          .:
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSR--WEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQV 97

  Fly   382 TLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISN---DIALIELNVVGALPGNISPICLP 443
            ..:||..:|         ..:::.:.:.|..|.....:.   ||||::|:....|..::.|:.||
Mouse    98 GQLRLYEND---------QLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSLP 153

  Fly   444 EAAKFMQQDFVGMNPFVAGWGAVK---------HQGVTSQVLRDAQVPIVSRHSCEQSYK----- 494
            .|:..:...   ...:|||||.::         |       ||:..||||..:.|||.|:     
Mouse   154 AASLRISSK---KTCWVAGWGVIENYMPLPPPYH-------LREVAVPIVENNDCEQKYQTNSSS 208

  Fly   495 -SIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYR----FYLLGLVSFGYECARPNF 554
             |..:.::  |.:||||....|:|:.||||||        |.|    :..:|:||:|..|..|:|
Mouse   209 DSTTRIIK--DDMLCAGKEGRDSCKADSGGPL--------VCRWNCSWVQVGVVSWGIGCGLPDF 263

  Fly   555 PGVYTRVASYVPWIKKHI 572
            |||||||.|||.|||.::
Mouse   264 PGVYTRVMSYVSWIKCYV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 85/272 (31%)
Tryp_SPc 328..571 CDD:238113 88/275 (32%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 86/273 (32%)
Tryp_SPc 35..277 CDD:214473 85/272 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.