DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and Tpsg1

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:296 Identity:99/296 - (33%)
Similarity:141/296 - (47%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 NAPRESATCG---ISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVI 371
            |:....:.||   :|.:.| |:|||..|..|.:||.|:|...:.:       :|||||:...:|:
Mouse    67 NSVSSGSGCGHPQVSNSGS-RIVGGHAAPAGTWPWQASLRLHKVH-------VCGGSLLSPEWVL 123

  Fly   372 TSAHC----INPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDL-------------NSIS 419
            |:|||    :|.....|.||             :|.:   .:..||..             ...|
Mouse   124 TAAHCFSGSVNSSDYQVHLG-------------ELTV---TLSPHFSTVKRIIMYTGSPGPPGSS 172

  Fly   420 NDIALIELNVVGALPGNISPICLPEAAKFMQQDFV-GMNPFVAGWGAVKHQGVTSQV-----LRD 478
            .||||::|:...||...:.|:|||||:    .||. ||..:|.|||   :.|....:     |::
Mouse   173 GDIALVQLSSPVALSSQVQPVCLPEAS----ADFYPGMQCWVTGWG---YTGEGEPLKPPYNLQE 230

  Fly   479 AQVPIVSRHSCEQSYK----SIFQFVQFSDKVLCAGSSSVDACQGDSGGPLMMPQLEGNVYRFYL 539
            |:|.:|...:|.|:|.    |:.|     ..:|||.... ||||.||||||:. |:.|.   :..
Mouse   231 AKVSVVDVKTCSQAYNSPNGSLIQ-----PDMLCARGPG-DACQDDSGGPLVC-QVAGT---WQQ 285

  Fly   540 LGLVSFGYECARPNFPGVYTRVASYVPWIKKHIASA 575
            .|:||:|..|.||:.||||.||.:||.||..||..|
Mouse   286 AGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 89/267 (33%)
Tryp_SPc 328..571 CDD:238113 90/269 (33%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 90/269 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.