DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and Prss8

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:281 Identity:98/281 - (34%)
Similarity:142/281 - (50%) Gaps:52/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 ATCGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCI--- 377
            |:||  .....|:.||..|:.|.:||..::.|      |.: .:|||||:.:::|:::|||.   
  Rat    35 ASCG--AVIQPRITGGGSAKPGQWPWQVSITY------NGV-HVCGGSLVSNQWVVSAAHCFPRE 90

  Fly   378 -NPMLTLVRLGAHDLSQPAESGAMDL---RIRRTVVHEHFDLNSISNDIALIELNVVGALPGNIS 438
             :.....|:||||.|    :|.:.|:   .:.:.:.|..:.......|||||.|:........|.
  Rat    91 HSKEEYEVKLGAHQL----DSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIR 151

  Fly   439 PICLPEA-AKFMQQDFVGMNPFVAGWG----AVKHQGVTSQVLRDAQVPIVSRHSCEQSYK---- 494
            |||||.| |.|..    |::..|.|||    :|..|  |.:.|:..:||::||.:|...|.    
  Rat   152 PICLPAANASFPN----GLHCTVTGWGHVAPSVSLQ--TPRPLQQLEVPLISRETCSCLYNINAV 210

  Fly   495 -----SIFQFVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARP 552
                 :|.|      .:||||  ....|||||||||||..| ::|   .:||.|:||:|..|..|
  Rat   211 PEEPHTIQQ------DMLCAGYVKGGKDACQGDSGGPLSCP-IDG---LWYLAGIVSWGDACGAP 265

  Fly   553 NFPGVYTRVASYVPWIKKHIA 573
            |.|||||..::|..||..|:|
  Rat   266 NRPGVYTLTSTYASWIHHHVA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 91/263 (35%)
Tryp_SPc 328..571 CDD:238113 92/265 (35%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 91/263 (35%)
Tryp_SPc 45..284 CDD:238113 92/265 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.