DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and Cela2a

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:283 Identity:94/283 - (33%)
Similarity:143/283 - (50%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 ISGATS------------NRVVGGMEARKGAYPWIAAL-----GYFEENNRNALKFLCGGSLIHS 367
            ::||.|            :|||||.||....:||..:|     |.:..|        |||||:.:
Mouse    11 VAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGRWRHN--------CGGSLVAN 67

  Fly   368 RYVITSAHCINPMLTL-VRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISN--DIALIELNV 429
            .:|:|:|||::...|. |.||||.||.|. :|:..:::.:.|||:.::..::.|  |||||:|..
Mouse    68 NWVLTAAHCLSNYQTYRVLLGAHSLSNPG-AGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLAS 131

  Fly   430 VGALPGNISPICLPEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCE---- 490
            ...|..||...|||.|...:.:::|   .:|.|||.::..|.:...||..::.:|...:|.    
Mouse   132 PVTLSKNIQTACLPPAGTILPRNYV---CYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASW 193

  Fly   491 --QSYKSIFQFVQFSDKVLCAGSSSV-DACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYE--CA 550
              .|.||         .::|||...| .:|.|||||||......|   ::.:.|:||||..  |.
Mouse   194 WGSSVKS---------SMVCAGGDGVTSSCNGDSGGPLNCRASNG---QWQVHGIVSFGSSLGCN 246

  Fly   551 RPNFPGVYTRVASYVPWIKKHIA 573
            .|..|.|:|||::|:.||...:|
Mouse   247 YPRKPSVFTRVSNYIDWINSVMA 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 88/257 (34%)
Tryp_SPc 328..571 CDD:238113 89/259 (34%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 88/257 (34%)
Tryp_SPc 31..267 CDD:238113 89/259 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.