DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and CTRC

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:155 Identity:53/155 - (34%)
Similarity:85/155 - (54%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 SATCGISGATSN---RVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHC 376
            :::||:.....|   |||||.:||..::||..:|.|.:   .:..:..|||:||.|.:|:|:|||
Human    14 ASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK---NDTWRHTCGGTLIASNFVLTAAHC 75

  Fly   377 INPMLTL-VRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPI 440
            |:...|. |.:|.::|....|.|::.:.:....||:.::...:.||||||:|.....|...|...
Human    76 ISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVA 140

  Fly   441 CLPEAAKFMQQDFVGMNP-FVAGWG 464
            ||||....:.:|:    | :|.|||
Human   141 CLPEKDSLLPKDY----PCYVTGWG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 50/140 (36%)
Tryp_SPc 328..571 CDD:238113 49/139 (35%)
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 50/140 (36%)
Tryp_SPc 30..>173 CDD:238113 49/139 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.