DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32260 and tmprss12

DIOPT Version :9

Sequence 1:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:274 Identity:101/274 - (36%)
Similarity:147/274 - (53%) Gaps:31/274 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 ESATCG---ISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAH 375
            :|..||   :.....:|:|||..|..||:||..:|.||  ...:.....||||||.:.:|:::||
 Frog    24 DSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYF--RTLSGYSHRCGGSLIQNNWVLSAAH 86

  Fly   376 CI----NPMLTLVRLGAHDLSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGN 436
            |.    ||......||.|::.... |..:..:|::.::|..:|..:|:|||||:.|:........
 Frog    87 CFRANRNPEYWRAVLGLHNIFMEG-SPVVKAKIKQIIIHASYDHIAITNDIALLLLHDFVTYSDY 150

  Fly   437 ISPICL-----PEAAKFMQQDFVGMNPFVAGWGAVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSI 496
            |.|:||     |::....         |:.|||..|.:|..|.:|::|.|..:....|..| .|.
 Frog   151 IHPVCLGSVTVPDSLTAC---------FITGWGVTKEKGSISVILQEALVQTIPYSECNSS-SSY 205

  Fly   497 FQFVQFSDKVLCAG--SSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECARPNFPGVYT 559
            ..|:  :..::|||  |.:||:||||||||.:....|.  .|||.:|:.||||.|.:||||||||
 Frog   206 NGFI--TQSMICAGDNSGAVDSCQGDSGGPFVCYNTER--MRFYQMGITSFGYGCGKPNFPGVYT 266

  Fly   560 RVASYVPWIKKHIA 573
            :|.|||.|||.|:|
 Frog   267 KVESYVSWIKAHMA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 93/251 (37%)
Tryp_SPc 328..571 CDD:238113 95/253 (38%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 95/253 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8300
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.