DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32249 and Uckl1

DIOPT Version :9

Sequence 1:NP_729001.2 Gene:CG32249 / 317939 FlyBaseID:FBgn0052249 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001365934.1 Gene:Uckl1 / 68556 MGIID:1915806 Length:549 Species:Mus musculus


Alignment Length:69 Identity:15/69 - (21%)
Similarity:27/69 - (39%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QIARPAPQVISVAAPR---NTYLPPQVISRPAPQ---------VVSIA-----RPAPQVVSIARP 122
            |..:|..::..:..||   ||.....::.....|         :.::|     .|.||.:|:.:.
Mouse   266 QYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEERKLRWDMAALASAHQCHPLPQTLSVLKS 330

  Fly   123 APQV 126
            .|||
Mouse   331 TPQV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32249NP_729001.2 PRK07994 <101..>215 CDD:236138 9/40 (23%)
Uckl1NP_001365934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
UMPK 101..299 CDD:238981 6/32 (19%)
UPRTase 330..533 CDD:405383 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11813
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.