powered by:
Protein Alignment CG32249 and Uckl1
DIOPT Version :9
Sequence 1: | NP_729001.2 |
Gene: | CG32249 / 317939 |
FlyBaseID: | FBgn0052249 |
Length: | 242 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001365934.1 |
Gene: | Uckl1 / 68556 |
MGIID: | 1915806 |
Length: | 549 |
Species: | Mus musculus |
Alignment Length: | 69 |
Identity: | 15/69 - (21%) |
Similarity: | 27/69 - (39%) |
Gaps: | 17/69 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 QIARPAPQVISVAAPR---NTYLPPQVISRPAPQ---------VVSIA-----RPAPQVVSIARP 122
|..:|..::..:..|| ||.....::.....| :.::| .|.||.:|:.:.
Mouse 266 QYIQPTMRLADIVVPRGSGNTVAIDLIVQHVHSQLEERKLRWDMAALASAHQCHPLPQTLSVLKS 330
Fly 123 APQV 126
.|||
Mouse 331 TPQV 334
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S11813 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.