DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32249 and tsc22d3

DIOPT Version :9

Sequence 1:NP_729001.2 Gene:CG32249 / 317939 FlyBaseID:FBgn0052249 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_021336669.1 Gene:tsc22d3 / 393541 ZFINID:ZDB-GENE-040426-1433 Length:756 Species:Danio rerio


Alignment Length:243 Identity:74/243 - (30%)
Similarity:120/243 - (49%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SLSRTYLPPQVQVVQPQVISVP---RVQVQPQIIERQVVPAPLVVPQVVPVYRPSPV-VQIARPA 80
            |...|..||         :|.|   |..|.....||..|.||  .|:..||..|:|. ..::.||
Zfish   227 SAPATERPP---------VSAPATERPPVSAPATERPPVSAP--APERPPVSAPAPERPPVSAPA 280

  Fly    81 PQ--VISVAAPRNTYLPPQVISRPAPQVVSIARPAPQVVSIARPAPQVVSIARPAPQVVSIARPA 143
            |:  .:|..||..   ||  :|.|||:...::.|||:...::.|||:...::.|||:...::.||
Zfish   281 PERPPVSAPAPER---PP--VSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPA 340

  Fly   144 PQVVSIARPAPEVVSIARPAPEVVSIARPAPQVVSIARPAPQVVSIARPAPQVVSIVRPAPQVVS 208
            |:...::.||||...::.||||...::.|||:...::.|||:...::.|||:...:..|||:...
Zfish   341 PERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPPVSAPAPERPP 405

  Fly   209 IARPAPQ---------VISVAAPRNTY---LPPQVIA----PRNTYLP 240
            ::.|||:         ::::.||....   .||:::|    ||...||
Zfish   406 VSAPAPERSPMPVPVWLLALPAPPKLLALPAPPRLLALPAPPRLLALP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32249NP_729001.2 PRK07994 <101..>215 CDD:236138 37/113 (33%)
tsc22d3XP_021336669.1 Atrophin-1 <177..653 CDD:331285 74/243 (30%)
DNA_pol3_gamma3 <590..>722 CDD:331207
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto38907
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5212
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.