DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32249 and Selplg

DIOPT Version :9

Sequence 1:NP_729001.2 Gene:CG32249 / 317939 FlyBaseID:FBgn0052249 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001382082.1 Gene:Selplg / 363930 RGDID:1307971 Length:430 Species:Rattus norvegicus


Alignment Length:213 Identity:56/213 - (26%)
Similarity:99/213 - (46%) Gaps:14/213 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PPQVQVVQPQVISVP-RVQVQPQIIERQVV----PAPLVVPQVVPVYRPSPVVQIARPAPQVISV 86
            ||:..:..|.:::.. .::....::|::|.    .:..|..||.......|..:  |||..::|.
  Rat    61 PPETLISVPNMVAAHLELRTMVAVLEQRVSAGAGTSETVTAQVATTGPADPDTE--RPAVGMLST 123

  Fly    87 AAPRNTYLPP-QVISRPAPQVVSIARPAPQVVSIARPAPQVVSIARPAPQVVSIARPAPQVVSIA 150
            .:.....|.| ::.:|.||.....::|||:....::|||.....::|||.....::|||:....:
  Rat   124 ESVTQRRLSPVEMTTRLAPTEAETSQPAPREAETSQPAPIKAETSQPAPIKAETSQPAPREAETS 188

  Fly   151 RPAPEVVSIARPAPEVVSIARPAPQVVSIARPAPQVVSIARPAPQVVSIVRPAPQVVSIARPAPQ 215
            :|||.....::|||.....::|||.....::|||..|..::|||......:|||.....::||. 
  Rat   189 QPAPTEAETSQPAPTKAETSQPAPTEAETSQPAPTEVETSQPAPTEAETSQPAPTEAETSQPAS- 252

  Fly   216 VISVAAPRNTYLP-PQVI 232
                .....|.|| .||:
  Rat   253 ----TETETTQLPRSQVV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32249NP_729001.2 PRK07994 <101..>215 CDD:236138 36/113 (32%)
SelplgNP_001382082.1 rne <95..282 CDD:236766 51/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto98597
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.