DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32249 and Selplg

DIOPT Version :9

Sequence 1:NP_729001.2 Gene:CG32249 / 317939 FlyBaseID:FBgn0052249 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_033177.3 Gene:Selplg / 20345 MGIID:106689 Length:417 Species:Mus musculus


Alignment Length:250 Identity:56/250 - (22%)
Similarity:88/250 - (35%) Gaps:69/250 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AVALLGVVGATSLSRTYLPPQVQVVQPQVISVPRVQVQPQIIERQVVPAPLVVPQVVPVYRPSPV 73
            ||.:|....||..|.|    .|:.|||                                  .|..
Mouse   115 AVGMLSTDSATQWSLT----SVETVQP----------------------------------ASTE 141

  Fly    74 VQIARPAPQVISVAAPRNTYLPPQVISRPAPQVVSIARPAPQVVSIARPAPQVVSIARPAPQVVS 138
            |:.::|||.....             |:|||.....::|||.....::|||.....::|||....
Mouse   142 VETSQPAPMEAET-------------SQPAPMEAETSQPAPMEAETSQPAPMEADTSQPAPMEAD 193

  Fly   139 IARPAPQVVSIARPAPEVVSIARPAPEVVSIARPAPQVVSIARPAP-QVVSIARPAPQVVSIVRP 202
            .::|||.....::|||.....::|||.....::|||.....::||| :..:...|..|.|..:..
Mouse   194 TSKPAPTEAETSKPAPTEAETSQPAPNEAETSKPAPTEAETSKPAPTEAETTQLPRIQAVKTLFT 258

  Fly   203 APQVVSIARPAPQVISVAA-----------PRNTYLPPQ------VIAPRNTYLP 240
            ......:....|..:..|:           |..|:||..      ::.|.|:..|
Mouse   259 TSAATEVPSTEPTTMETASTESNESTIFLGPSVTHLPDSGLKKGLIVTPGNSPAP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32249NP_729001.2 PRK07994 <101..>215 CDD:236138 30/114 (26%)
SelplgNP_033177.3 rne <133..276 CDD:236766 40/189 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5212
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.