DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and EXT3

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_173553.1 Gene:EXT3 / 838728 AraportID:AT1G21310 Length:431 Species:Arabidopsis thaliana


Alignment Length:489 Identity:195/489 - (39%)
Similarity:220/489 - (44%) Gaps:143/489 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIAFALVAVASAD-VSHLFSNSNNLQEDGYHYAPPSAPVVIDVPYVPHESAPPRVVVYEAPK 64
            |..|:|..||...|.. ||...:|        |.|:.|..||....|.|.|.|.||   ||.:|.
plant     5 MASLVATLLVLTISLTFVSQSTAN--------YFYSSPPPPVKHYTPPVKHYSPPP---VYHSPP 58

  Fly    65 P--------KPTPPRPVYTPPVVIPSEPAGVLKDDGYHYGQPSVKFEVSAPPPPKVEYL----PP 117
            |        .|.||...|:||.|             ||           :|||||..|:    ||
plant    59 PPKKHYEYKSPPPPVKHYSPPPV-------------YH-----------SPPPPKKHYVYKSPPP 99

  Fly   118 PTKKVVIAPPPVY--VPPPTKKVVYTPPPPPPTKKVVYTPP-----PPPPTKKVVYTPPPPPPTK 175
            |.|.  .:|||||  .|||.|..||..||||...   |:||     ||||.|..||..||||...
plant   100 PVKH--YSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPVKH 159

  Fly   176 KVVYTPPP----PPPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL----PPPT 232
               |:|||    ||||.|..||..||..:     .||..|.|   ..:||.||..|:    |||.
plant   160 ---YSPPPVYHSPPPPKKHYVYKSPPPPV-----KHYSPPPV---YHSPPPPKKHYVYKSPPPPV 213

  Fly   233 KKVVIAPPPVY--VPPPTKKVIYTPPPPPPTKKVVYTPP-----PPPPTKKVVY-TPPPP----- 284
            |.  .:|||||  .|||.|..:|..||||...   |:||     ||||.|..|| :||||     
plant   214 KH--YSPPPVYHSPPPPKKHYVYKSPPPPVKH---YSPPPVYHSPPPPKKHYVYKSPPPPVKHYS 273

  Fly   285 -------PPPPKK-VVYTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYL---PPPPTKKVYV 338
                   |||||| .||..||..:     .||..|.|   ..:||.||..|:   ||||.|. |.
plant   274 PPPVYHSPPPPKKHYVYKSPPPPV-----KHYSPPPV---YHSPPPPKKHYVYKSPPPPVKH-YS 329

  Fly   339 APPVY-VPPPTKKVVVY-TPPPP-----PPPVY-IPPPTKKVVVY-TPPPP------------PP 382
            .|||| .|||.||..|| :||||     ||||| .|||.||..|| :||||            ||
plant   330 PPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPP 394

  Fly   383 PTKKVYV-----TPKVEYLPPVQKGYSYPNDPQP 411
            |.|:.||     .|.|.:..|....|.|.:.|.|
plant   395 PPKEKYVYKSPPPPPVHHYSPPHHPYLYKSPPPP 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
EXT3NP_173553.1 Extensin_2 29..100 CDD:252669 31/97 (32%)
Extensin_2 92..156 CDD:252669 32/68 (47%)
Extensin_2 148..212 CDD:252669 29/74 (39%)
Extensin_2 204..268 CDD:252669 31/68 (46%)
Extensin_2 260..324 CDD:252669 27/71 (38%)
Extensin_2 316..380 CDD:252669 36/64 (56%)
Extensin_2 372..428 CDD:252669 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.