DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and cited4a

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_001038447.2 Gene:cited4a / 562291 ZFINID:ZDB-GENE-030131-7661 Length:240 Species:Danio rerio


Alignment Length:59 Identity:13/59 - (22%)
Similarity:21/59 - (35%) Gaps:17/59 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VAVASADVSHLFSNSN-NLQEDGYHYAPPSAPVVIDVPYVPHESAPPRVVVYEAPKPKP 67
            ||:...:..:...||. |.|..|.|               ||:..... ::|.:|..:|
Zfish    58 VAMRQRNAMNGIMNSQVNGQMSGGH---------------PHQMQQAN-MMYASPNQQP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
cited4aNP_001038447.2 CITED 1..240 CDD:282356 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.