powered by:
Protein Alignment CG32241 and cited4a
DIOPT Version :9
Sequence 1: | NP_729000.2 |
Gene: | CG32241 / 317934 |
FlyBaseID: | FBgn0052241 |
Length: | 415 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001038447.2 |
Gene: | cited4a / 562291 |
ZFINID: | ZDB-GENE-030131-7661 |
Length: | 240 |
Species: | Danio rerio |
Alignment Length: | 59 |
Identity: | 13/59 - (22%) |
Similarity: | 21/59 - (35%) |
Gaps: | 17/59 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 VAVASADVSHLFSNSN-NLQEDGYHYAPPSAPVVIDVPYVPHESAPPRVVVYEAPKPKP 67
||:...:..:...||. |.|..|.| ||:..... ::|.:|..:|
Zfish 58 VAMRQRNAMNGIMNSQVNGQMSGGH---------------PHQMQQAN-MMYASPNQQP 100
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32241 | NP_729000.2 |
None |
cited4a | NP_001038447.2 |
CITED |
1..240 |
CDD:282356 |
13/59 (22%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.