DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and CG7016

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_651301.1 Gene:CG7016 / 42968 FlyBaseID:FBgn0039238 Length:362 Species:Drosophila melanogaster


Alignment Length:243 Identity:63/243 - (25%)
Similarity:82/243 - (33%) Gaps:71/243 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPP--------PPPPKKVVYTPPPT 198
            |||.|....  ..||||.|.......|||.|....  ..||||        ||||:     |...
  Fly   165 PPPRPGFNG--GGPPPPRPGWNGGGPPPPMPGWNG--GGPPPPRPGWNGGGPPPPR-----PGWN 220

  Fly   199 GILKDDGYHY----GQPSVKFEVSAPPAPKVEYLP-------PPTKKVVIAPPPVYVPPPTKKVI 252
            |.::.:..:|    .||.       |..|...:.|       |.|.    .|.|::   ||    
  Fly   221 GGMEQEWDNYPRLPDQPD-------PNDPNTNWNPDNESSTTPQTP----IPGPIF---PT---- 267

  Fly   253 YTPPPPPPTKKVVYTPPPPPPTKK--VVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSVKF 315
             |.|.|.||...:...|...|||.  ::.|..||..||    :.|.|             |:..|
  Fly   268 -TTPKPEPTFPTIQPRPTAQPTKDTLIIGTNRPPLVPP----HNPDP-------------PTPTF 314

  Fly   316 EVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPV 363
            .....|.|.     |.|..::.....:..|..:|.:.|..|..|..|:
  Fly   315 PTWIVPEPL-----PKPLDELSENRAIIFPSSSKYIHVPNPEVPSIPI 357



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.