DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and CG5225

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster


Alignment Length:356 Identity:107/356 - (30%)
Similarity:125/356 - (35%) Gaps:128/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GYHYGQPSVKFEVSAPPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPP 156
            |:.:|..:.|       .|..|     |.:::.:......|.|.:.|:|..||..      |.||
  Fly    11 GWAFGLANSK-------NPSAE-----TGRLIASLQAAPAPAPAQSVIYKLPPQH------YYPP 57

  Fly   157 PPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGIL-----------KDDGYHYGQ 210
            |||        ||||||........||.||.|..:..||.|.|..           |.:..|||.
  Fly    58 PPP--------PPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGPKGHTGSKGERGEKGERGHYGL 114

  Fly   211 PSVKFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKK-----------VIYTPPPPPPTKKV 264
            |....|    |.|             |.||.:..||..|.           ..:..|||||    
  Fly   115 PGQPGE----PGP-------------IGPPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPP---- 158

  Fly   265 VYTPPPPPPTKKVVYTPPPPPPP--------PKKVVYTPP-----PTGILK-DDGYHYGQPSVKF 315
               ||||||       |||||||        |...:.|||     |....| :.|:|:.....| 
  Fly   159 ---PPPPPP-------PPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSK- 212

  Fly   316 EVSAPPAPKVEYLPPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPP 380
               .||.|     |.||.    ..||   .||......|..||||||              ||||
  Fly   213 ---GPPGP-----PGPPG----TGPP---GPPGPPGTTYPQPPPPPP--------------PPPP 248

  Fly   381 PPPTKKVYVTPKVEYLPPVQKGYSYPNDPQP 411
            |||:   |..|...|.||  ..|..|..|.|
  Fly   249 PPPS---YPYPPYPYPPP--GPYPGPWIPLP 274



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.