DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and CG13138

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster


Alignment Length:206 Identity:50/206 - (24%)
Similarity:77/206 - (37%) Gaps:54/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV 213
            |:::.|.|.|.|.:|||:.     |.:|:|          :|:|:.|....:..:...|.     
  Fly   182 KELIKTVPQPYPVEKVVHV-----PIEKIV----------EKIVHVPKLVNVTVEKIVHV----- 226

  Fly   214 KFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPP------TKKVIYTPPPPPPTKKVVYTPPPPP 272
                   |..|:      .:||:..|.||.||.|      .:|:::.|.|.|    |:.|.|.|.
  Fly   227 -------PIEKI------VEKVIHIPKPVQVPKPYVVEKIIEKIVHVPKPYP----VLRTVPYPV 274

  Fly   273 PTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYGQPSV----------KFEVSAPPAPKVEY 327
            ..|..|:.....|.|.|..|....|..|...:.|.:...|:          ||.:.....|..|:
  Fly   275 EIKVPVHLEKKVPVPYKVEVERKVPVYIRSSEPYKFESSSLYESYPRGEEFKFNMEMDHPPPREH 339

  Fly   328 LPPP-PTKKVY 337
            .|.. |:...|
  Fly   340 EPSSLPSSNYY 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
CG13138NP_609372.1 IMCp 188..279 CDD:289112 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.