DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and CG31817

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster


Alignment Length:106 Identity:23/106 - (21%)
Similarity:34/106 - (32%) Gaps:44/106 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 PPKKVVYTPP------------------PTGILKD-DGYHYGQPSV----KFEVSAPP----APK 324
            |.:||..||.                  ||  .|| .||...:..:    ::||..|.    ..|
  Fly   235 PQRKVSKTPSRSSGNSTDFCRCNQHISGPT--YKDYGGYSPSETEIEMGSEYEVKIPSRYDHLNK 297

  Fly   325 VEYLPPPPTK---------------KVYVAPPVYVPPPTKK 350
            :|.:..|||.               :.|:|...|...|.::
  Fly   298 IEKVSKPPTNVDTKWRFKMPSNSEVQEYMASRTYENVPVRQ 338



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.