DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32241 and PSORS1C2

DIOPT Version :9

Sequence 1:NP_729000.2 Gene:CG32241 / 317934 FlyBaseID:FBgn0052241 Length:415 Species:Drosophila melanogaster
Sequence 2:NP_054788.2 Gene:PSORS1C2 / 170680 HGNCID:17199 Length:136 Species:Homo sapiens


Alignment Length:151 Identity:43/151 - (28%)
Similarity:55/151 - (36%) Gaps:57/151 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 PPTGILKDDGYHYGQPSVKFEVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPPPP 260
            ||.    :|....|.|::      |..|.|...|.|.     |||....||||:       |..|
Human    30 PPA----EDREEAGSPTL------PQGPPVPGDPWPG-----APPLFEDPPPTR-------PSRP 72

  Fly   261 TKKV----VYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPPTGILKDDGYHYG-QPSVKFEVSAP 320
            .:.:    |:.|.||       .|.||.||.|              ||.:..| ||.   |...|
Human    73 WRDLPETGVWLPEPP-------RTDPPQPPRP--------------DDPWPAGPQPP---ENPWP 113

  Fly   321 PAPKVEYLP------PPPTKK 335
            |||:|:..|      .||.::
Human   114 PAPEVDNRPQEEPDLDPPREE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32241NP_729000.2 None
PSORS1C2NP_054788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..136 43/151 (28%)
SPR1 23..136 CDD:292000 43/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.