DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-MLRQ and NDUFA4

DIOPT Version :10

Sequence 1:NP_730777.1 Gene:ND-MLRQ / 317928 FlyBaseID:FBgn0052230 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_002480.1 Gene:NDUFA4 / 4697 HGNCID:7687 Length:81 Species:Homo sapiens


Alignment Length:73 Identity:41/73 - (56%)
Similarity:50/73 - (68%) Gaps:2/73 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KKNPALIPLYVCVGAGAIGAVYYMARLATRNPDVTWNRTSNPEPWQEY-KEKQYKFYSPVRDYSK 73
            ||:|:||||:|.:|.||.||..|:.|||..||||.|:| :|||||.:. ...||||||...||||
Human    10 KKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDR-NNPEPWNKLGPNDQYKFYSVNVDYSK 73

  Fly    74 TKSAAPNF 81
            .|...|:|
Human    74 LKKERPDF 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-MLRQNP_730777.1 B12D 11..78 CDD:461937 38/67 (57%)
NDUFA4NP_002480.1 B12D 11..78 CDD:461937 38/67 (57%)

Return to query results.
Submit another query.