DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-MLRQ and AA467197

DIOPT Version :10

Sequence 1:NP_730777.1 Gene:ND-MLRQ / 317928 FlyBaseID:FBgn0052230 Length:83 Species:Drosophila melanogaster
Sequence 2:NP_001004174.1 Gene:AA467197 / 433470 MGIID:3034182 Length:83 Species:Mus musculus


Alignment Length:78 Identity:26/78 - (33%)
Similarity:35/78 - (44%) Gaps:8/78 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QSLKKNPALIPLYVCVGAGAIGAVYYMARLATRNPDVTWNRTSNPEPWQEYKEKQ-------YKF 64
            |.|.||..||||...:...|.||..: |..|.:..||..:|..|||||:.....|       .:.
Mouse     5 QILMKNKELIPLAFFISVAATGATSF-ALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQ 68

  Fly    65 YSPVRDYSKTKSA 77
            :.||.:..|.:.|
Mouse    69 WKPVEELQKVRRA 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-MLRQNP_730777.1 B12D 11..78 CDD:461937 24/74 (32%)
AA467197NP_001004174.1 B12D 9..76 CDD:461937 22/67 (33%)

Return to query results.
Submit another query.