DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and VFB1

DIOPT Version :9

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_175151.1 Gene:VFB1 / 841121 AraportID:AT1G47056 Length:518 Species:Arabidopsis thaliana


Alignment Length:469 Identity:96/469 - (20%)
Similarity:163/469 - (34%) Gaps:138/469 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LDPSSLLFIFKLLSLEDQLHLARCCR----IFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFLW 70
            |....|..:|:.|:..::...|..||    :......||..|...|::                 
plant    43 LPDECLALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLI----------------- 90

  Fly    71 LCGSRIGTLESHFDDDHPLQLLPMISRHCYRLKSISIYNATVARAQPYLLRMSSLEKVHVR---- 131
               :.|.:|.|.||.      :..:|..|.| :|:||.:..:.:..   ||..:|:::.:|    
plant    91 ---TSIPSLFSRFDS------VTKLSLKCDR-RSVSIGDEALVKIS---LRCRNLKRLKLRACRE 142

  Fly   132 -------NYKSTSKDL--------------IKAIGIHLPRVNSLSLESFERKELQEVRQFSEMLE 175
                   .:....|||              :||:..|...:..||        ::.:|.|:::..
plant   143 LTDVGMAAFAENCKDLKIFSCGSCDFGAKGVKAVLDHCSNLEELS--------IKRLRGFTDIAP 199

  Fly   176 LGLYDDVTASEFATIVKPMRKLRCL-QLRNAKRFLTTSNLRMLATNCRHLEKLTFNDCDADL-LV 238
            ..:...|.||...:|        || :|.|.:.|      ..:....::|:.|....|..|. |:
plant   200 EMIGPGVAASSLKSI--------CLKELYNGQCF------GPVIVGAKNLKSLKLFRCSGDWDLL 250

  Fly   239 LPQF---------VNLKYLQL---------YCSEDMKTRLFK---------ALAKSQCSIQLEYL 276
            |.:.         ::|:.:|:         |||......|.|         |....:|.   ...
plant   251 LQEMSGKDHGVVEIHLERMQVSDVALSAISYCSSLESLHLVKTPECTNFGLAAIAEKCK---RLR 312

  Fly   277 ILHRKRW----IDEE----QAQYISALKCLRWLVCKPRDDLCVHHLAKLSRLECLSIQSAREIGE 333
            .||...|    |.:|    .|::.|.|:.|..:...|.........||...||.|::......|:
plant   313 KLHIDGWKANLIGDEGLVAVAKFCSQLQELVLIGVNPTTLSLGMLAAKCLNLERLALCGCDTFGD 377

  Fly   334 TQLSLLVANNERLRYLNICYCLGITDAFVLDTLAS----LSKRSAHQTLELFAAATD-------- 386
            .:||.:.|....||.|.|..| .|:|..: :.||:    |:|....:...:.....|        
plant   378 PELSCIAAKCPALRKLCIKNC-PISDVGI-ENLANGCPGLTKVKIKKCKGVLGGCADWLRTVRPM 440

  Fly   387 --IRHDIMERLPHE 398
              :..|.||: .||
plant   441 LSVNADTMEQ-EHE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 5/26 (19%)
leucine-rich repeat 224..244 CDD:275381 6/29 (21%)
leucine-rich repeat 245..272 CDD:275381 9/44 (20%)
leucine-rich repeat 273..297 CDD:275381 8/31 (26%)
leucine-rich repeat 298..319 CDD:275381 4/20 (20%)
leucine-rich repeat 320..345 CDD:275381 7/24 (29%)
leucine-rich repeat 346..372 CDD:275381 10/29 (34%)
VFB1NP_175151.1 F-box-like 41..>70 CDD:403981 7/26 (27%)
AMN1 87..>202 CDD:187754 26/152 (17%)
leucine-rich repeat 103..125 CDD:275381 6/22 (27%)
leucine-rich repeat 132..157 CDD:275381 2/24 (8%)
leucine-rich repeat 158..182 CDD:275381 4/23 (17%)
leucine-rich repeat 183..224 CDD:275381 12/56 (21%)
leucine-rich repeat 235..260 CDD:275381 6/24 (25%)
leucine-rich repeat 261..284 CDD:275381 4/22 (18%)
AMN1 271..>412 CDD:187754 35/145 (24%)
leucine-rich repeat 285..310 CDD:275381 4/27 (15%)
leucine-rich repeat 311..338 CDD:275381 6/26 (23%)
leucine-rich repeat 339..363 CDD:275381 5/23 (22%)
leucine-rich repeat 364..389 CDD:275381 7/24 (29%)
leucine-rich repeat 390..414 CDD:275381 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.