DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and AT4G15475

DIOPT Version :9

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_567467.1 Gene:AT4G15475 / 827219 AraportID:AT4G15475 Length:610 Species:Arabidopsis thaliana


Alignment Length:318 Identity:81/318 - (25%)
Similarity:128/318 - (40%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QLLPMISRHCYRLKSISIYNATVARAQPYLLRMSSLEKVHVRNYKSTSKDLIKAIGIHLPRVNSL 154
            ||..:..|.|..|..:.:.:..|..::       ||:.:.|......:...::|:|.|...:..|
plant   192 QLEELNLRFCEGLTDVGVIDLVVGCSK-------SLKSIGVAASAKITDLSLEAVGSHCKLLEVL 249

  Fly   155 SLES--FERKELQEVRQFSEMLE-LGLY-DDVTASEFATIVKPMRKLRCLQLRNAKRFLTTSNLR 215
            .|:|  ...|.|..|.|....|: |.|. ..||...||.:.:....|..|.|.:.:.| |...:|
plant   250 YLDSEYIHDKGLIAVAQGCHRLKNLKLQCVSVTDVAFAAVGELCTSLERLALYSFQHF-TDKGMR 313

  Fly   216 MLATNCRHLEKLTFNDCDADLLVLPQFVNLKYLQLY---CSE----------DMKTRLFKALAKS 267
            .:....:.|:.||.:||        .||:.|.|:..   |.|          ::.||..:|:.||
plant   314 AIGKGSKKLKDLTLSDC--------YFVSCKGLEAIAHGCKELERVEINGCHNIGTRGIEAIGKS 370

  Fly   268 QCSIQLEYLILHRKRWIDEEQAQYI----SALKCLRWLVCKPRDDLCVHHLAKLSR-LECLSIQS 327
             |....|..:|:.:| |.....|.|    .:|:.|..:.|....|:.:..:||..| |:.|.|:.
plant   371 -CPRLKELALLYCQR-IGNSALQEIGKGCKSLEILHLVDCSGIGDIAMCSIAKGCRNLKKLHIRR 433

  Fly   328 AREIGE-------------TQLSL----------LVANNE--RLRYLNICYCLGITDA 360
            ..|||.             |:|||          |:|..:  .|:.||:..|..|:||
plant   434 CYEIGNKGIISIGKHCKSLTELSLRFCDKVGNKALIAIGKGCSLQQLNVSGCNQISDA 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 6/25 (24%)
leucine-rich repeat 224..244 CDD:275381 6/19 (32%)
leucine-rich repeat 245..272 CDD:275381 10/39 (26%)
leucine-rich repeat 273..297 CDD:275381 7/27 (26%)
leucine-rich repeat 298..319 CDD:275381 5/20 (25%)
leucine-rich repeat 320..345 CDD:275381 12/49 (24%)
leucine-rich repeat 346..372 CDD:275381 7/15 (47%)
AT4G15475NP_567467.1 FBOX 11..>42 CDD:197608
leucine-rich repeat 142..167 CDD:275381
leucine-rich repeat 168..192 CDD:275381 81/318 (25%)
AMN1 190..359 CDD:187754 43/182 (24%)
leucine-rich repeat 193..218 CDD:275381 5/24 (21%)
leucine-rich repeat 220..245 CDD:275381 5/24 (21%)
leucine-rich repeat 246..263 CDD:275381 5/16 (31%)
leucine-rich repeat 271..295 CDD:275381 7/23 (30%)
leucine-rich repeat 296..321 CDD:275381 6/25 (24%)
leucine-rich repeat 322..347 CDD:275381 10/32 (31%)
AMN1 <345..514 CDD:187754 40/149 (27%)
leucine-rich repeat 348..369 CDD:275381 3/20 (15%)
leucine-rich repeat 374..399 CDD:275381 6/25 (24%)
leucine-rich repeat 400..425 CDD:275381 6/24 (25%)
leucine-rich repeat 426..451 CDD:275381 6/24 (25%)
AMN1 <448..586 CDD:187754 13/44 (30%)
leucine-rich repeat 452..476 CDD:275381 6/23 (26%)
leucine-rich repeat 477..502 CDD:275381 7/15 (47%)
leucine-rich repeat 503..528 CDD:275381
leucine-rich repeat 529..554 CDD:275381
leucine-rich repeat 555..580 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.