DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbxl4

DIOPT Version :9

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_572951.1 Gene:Fbxl4 / 32378 FlyBaseID:FBgn0030555 Length:669 Species:Drosophila melanogaster


Alignment Length:398 Identity:80/398 - (20%)
Similarity:142/398 - (35%) Gaps:97/398 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILDLDPSSLLFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFLWL 71
            :.||....||.|...|.|:....:....|.|.|    :.||   .::..::|::.       .| 
  Fly   326 LTDLPFEILLRILSYLDLKSLFRVGHVSRTFYD----ISRH---PLLYAEISLKP-------YW- 375

  Fly    72 CGSRIGTLESHFDDDHPLQLLPMISRHCYRLKSISIY------NATVARAQPYLL-RMSSLEKVH 129
                         |....:||..::|....|:.:.:.      |.:....:.:|. |..:|..:.
  Fly   376 -------------DVASSELLCTLARRATMLRKLDLSWCGGFGNVSPTEFKKFLTQRGDNLTHLR 427

  Fly   130 VRNYKSTSKDLIKAIGIHLPRVNSLSLES-------------FERKELQEVRQFSEMLELGLYDD 181
            :.:.|..:...|:.:||....:..|||.:             ...|.|:.:..|....|..|   
  Fly   428 LNSCKFLNASCIENVGIVCDNLIELSLRNCATEPPLLNFSCLANLKNLERLDLFQTYFETEL--- 489

  Fly   182 VTASEFATIVKPMRKLRCLQLR---------NAKRFLTTSNLRMLATNCRHLEKLTFNDCDADLL 237
                 ..::::..|||:.|.|.         |....|.|.|.::::.:   |.|..|.. ...|.
  Fly   490 -----LLSMLEGNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLD---LWKAHFLS-SRGLQ 545

  Fly   238 VLPQFVNLKYLQL-YCSED--MKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQAQYISALKCLR 299
            .|.:...|:.|.| :|..:  :...||:.|  |.|. :|:.|.|...|...|....:|:||.   
  Fly   546 SLARLHQLEELDLGWCMREASLGDGLFQLL--SNCP-KLKKLFLSAVRGTTERDLMHIAALG--- 604

  Fly   300 WLVCKPRDDLCVHHLAKLSRLECLSIQSAREIGETQLSLLVANNERLRYLNICYCLGITDAFVLD 364
                              ..||.|.:.....|...::..::.|..:|:.|::.:|..|.|. ..|
  Fly   605 ------------------KNLEQLDLMGILNITHERVYDILVNCPKLQLLDLSFCDNIMDR-DFD 650

  Fly   365 TLASLSKR 372
            .||..|::
  Fly   651 LLAEWSRQ 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 7/34 (21%)
leucine-rich repeat 224..244 CDD:275381 5/19 (26%)
leucine-rich repeat 245..272 CDD:275381 9/29 (31%)
leucine-rich repeat 273..297 CDD:275381 8/23 (35%)
leucine-rich repeat 298..319 CDD:275381 0/20 (0%)
leucine-rich repeat 320..345 CDD:275381 5/24 (21%)
leucine-rich repeat 346..372 CDD:275381 9/25 (36%)
Fbxl4NP_572951.1 F-box-like 326..372 CDD:289689 13/52 (25%)
leucine-rich repeat 393..422 CDD:275381 4/28 (14%)
leucine-rich repeat 423..442 CDD:275381 3/18 (17%)
LRR_RI 437..>641 CDD:238064 49/239 (21%)
leucine-rich repeat 449..474 CDD:275381 3/24 (13%)
leucine-rich repeat 475..499 CDD:275381 4/31 (13%)
leucine-rich repeat 500..527 CDD:275381 7/26 (27%)
leucine-rich repeat 528..552 CDD:275381 5/27 (19%)
AMN1 552..>660 CDD:187754 31/132 (23%)
leucine-rich repeat 553..580 CDD:275381 9/29 (31%)
leucine-rich repeat 581..606 CDD:275381 8/45 (18%)
leucine-rich repeat 607..632 CDD:275381 5/24 (21%)
leucine-rich repeat 633..652 CDD:275381 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.