DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and Fbxl12

DIOPT Version :9

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:147 Identity:35/147 - (23%)
Similarity:64/147 - (43%) Gaps:15/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LTTSNLRMLATNCRHLEKLTFNDCDADLLVLPQFVN-LKYLQLYCSEDMKTRLFKALAKSQCSIQ 272
            |:.:.:|.|...|.:|::|..:..|..::.:....: |:.|:|:..|.....|.|....:...: 
Mouse   112 LSPALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPL- 175

  Fly   273 LEYLILHRKRWIDEEQAQYISALKCLRWL-------VCKPRDDLCVHHLAKLSRLECLSIQSARE 330
            ||.::|.|.....:|..|.::..:.||.|       |.:...|..:..|:.|.|||.|....:.:
Mouse   176 LECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDASLQELSYLQRLEVLGCTLSAD 240

  Fly   331 IGETQLSLLVANNERLR 347
                  |.|:|.:..||
Mouse   241 ------STLLAISRHLR 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 4/13 (31%)
leucine-rich repeat 224..244 CDD:275381 3/19 (16%)
leucine-rich repeat 245..272 CDD:275381 6/26 (23%)
leucine-rich repeat 273..297 CDD:275381 6/23 (26%)
leucine-rich repeat 298..319 CDD:275381 7/27 (26%)
leucine-rich repeat 320..345 CDD:275381 6/24 (25%)
leucine-rich repeat 346..372 CDD:275381 2/2 (100%)
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689
leucine-rich repeat 127..148 CDD:275381 3/20 (15%)
AMN1 144..>249 CDD:187754 26/111 (23%)
leucine-rich repeat 149..175 CDD:275381 6/25 (24%)
leucine-rich repeat 176..200 CDD:275381 6/23 (26%)
leucine-rich repeat 201..226 CDD:275381 6/24 (25%)
leucine-rich repeat 227..252 CDD:275381 10/31 (32%)
leucine-rich repeat 253..276 CDD:275381
leucine-rich repeat 277..306 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.