DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32221 and pof2

DIOPT Version :9

Sequence 1:NP_730456.2 Gene:CG32221 / 317924 FlyBaseID:FBgn0052221 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_596079.1 Gene:pof2 / 2540355 PomBaseID:SPBC25B2.11 Length:463 Species:Schizosaccharomyces pombe


Alignment Length:423 Identity:97/423 - (22%)
Similarity:157/423 - (37%) Gaps:133/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFIFKLLSLEDQLHLARCCRIFRDAFLRLHRHDFQDVVDKDMSIRTLEDWRTFLWLCGSRIGTLE 80
            |.:..|.:...:|:|:.|.||......:|        :.:::::.|:.         .|.|.:| 
pombe    87 LMLMTLATGISRLNLSGCTRISEPLIGKL--------LYQNLNLVTIN---------FSNIFSL- 133

  Fly    81 SHFDDDHPLQLLPMISRHCYRLKSISIYN---------ATVARAQPYLLRM-----SSLEKVHVR 131
                   |..:|..||.:|..||:::|.|         ..:.:..|||.|:     ..|..|.::
pombe   134 -------PANILEYISDNCPNLKALNIGNCGLVEDTGMVQIIKRCPYLNRLIIPNCRKLTDVSLQ 191

  Fly   132 NYKSTSKDLIK-----AIGIHLPRVNSLS-LESFER--KELQ-----EVRQFSEMLELGLYDDVT 183
             ..|..:|||:     ..|.|  ..::|| |.|..|  |||.     |:..|...|.|....|. 
pombe   192 -ILSEKEDLIELDISGCEGFH--NADTLSRLVSRNRGLKELSMDGCTELSHFITFLNLNCELDA- 252

  Fly   184 ASEFATIVKPMRKLRCLQLRNAKRFLTTSNLRMLATNCRHLEKLTFNDC----DADLLVLPQF-V 243
                         :|.|.|.|... |..|::.::......|..|..:.|    |:.||.|.:. .
pombe   253 -------------MRALSLNNLPD-LKDSDIELITCKFSKLNSLFLSKCIGLTDSSLLSLTKLSQ 303

  Fly   244 NLKYLQL-YCSE--DMKTRLFKALAKSQCSIQLEYLILHRKRWIDEEQAQYISALKCLRWLVCKP 305
            :|..|.| :|.|  |:..   :.|.|| |                 :...||....|||      
pombe   304 SLTTLHLGHCYEITDIGV---QCLLKS-C-----------------KNITYIDFGGCLR------ 341

  Fly   306 RDDLCVHHLAKLSRLE------CLSIQSAREIGETQLSLLVAN---NERLRYLNICYCLGITDAF 361
            ..|:.|..:|||..|:      |:.:        |.||:::.:   :..|..:::.||:|:|...
pombe   342 LSDIAVSAIAKLPYLQRVGLVKCICL--------TDLSVILLSGSFSRNLERVHLSYCIGLTAKS 398

  Fly   362 V------LDTLASLSKRSAHQTLELFAAATDIR 388
            |      ..||..||....:..|     .|::|
pombe   399 VSYLMYNCKTLKHLSVTGINSIL-----CTELR 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32221NP_730456.2 leucine-rich repeat 197..223 CDD:275381 6/25 (24%)
leucine-rich repeat 224..244 CDD:275381 7/24 (29%)
leucine-rich repeat 245..272 CDD:275381 10/29 (34%)
leucine-rich repeat 273..297 CDD:275381 2/23 (9%)
leucine-rich repeat 298..319 CDD:275381 7/20 (35%)
leucine-rich repeat 320..345 CDD:275381 5/33 (15%)
leucine-rich repeat 346..372 CDD:275381 10/31 (32%)
pof2NP_596079.1 F-box-like 2..45 CDD:289689
leucine-rich repeat 96..121 CDD:275381 6/32 (19%)
leucine-rich repeat 122..141 CDD:275381 6/35 (17%)
AMN1 <143..292 CDD:187754 39/166 (23%)
leucine-rich repeat 148..173 CDD:275381 4/24 (17%)
leucine-rich repeat 174..225 CDD:275381 14/53 (26%)
leucine-rich repeat 226..278 CDD:275381 14/66 (21%)
AMN1 <278..428 CDD:187754 45/189 (24%)
leucine-rich repeat 279..304 CDD:275381 7/24 (29%)
leucine-rich repeat 305..330 CDD:275381 10/45 (22%)
leucine-rich repeat 331..355 CDD:275381 10/29 (34%)
leucine-rich repeat 356..382 CDD:275381 5/33 (15%)
leucine-rich repeat 383..408 CDD:275381 6/24 (25%)
leucine-rich repeat 409..427 CDD:275381 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.