DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32219 and CG33710

DIOPT Version :9

Sequence 1:NP_730469.1 Gene:CG32219 / 317922 FlyBaseID:FBgn0052219 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001027137.1 Gene:CG33710 / 3772611 FlyBaseID:FBgn0053710 Length:162 Species:Drosophila melanogaster


Alignment Length:138 Identity:41/138 - (29%)
Similarity:60/138 - (43%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RNTYEDCNHNHSAVEDHYDCGCCPGISNNNGQVVGFHCHKDDQNSILRFASDEESAFAECVPNCF 77
            |..|...:|:    :....||.|..|.|.:.. .||.||.:|:..:.....:.:..:|.|||..:
  Fly    30 RKFYNTADHS----QGFPICGNCTNIKNVHIS-TGFTCHFEDERQVENKFGETDDKYAPCVPKDY 89

  Fly    78 EIKYPIQEYCCFWSPKLGCTILVNEKYF-SNKDLCNNCKYFC------QRTTGDGRSSSYPQKLI 135
            .|...::.|||||||..||:.|:....| .:.|.|:.||..|      ..:.|..|...|...:.
  Fly    90 VINGEVKNYCCFWSPTSGCSALIGRLLFDKSSDYCDTCKGSCSGLKYSDDSVGSNRIPEYGFIMA 154

  Fly   136 LLLSLLLI 143
            ||...|.|
  Fly   155 LLFCELWI 162



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.