DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32219 and CG33710

DIOPT Version :10

Sequence 1:NP_730469.1 Gene:CG32219 / 317922 FlyBaseID:FBgn0052219 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001027137.1 Gene:CG33710 / 3772611 FlyBaseID:FBgn0053710 Length:162 Species:Drosophila melanogaster


Alignment Length:39 Identity:9/39 - (23%)
Similarity:16/39 - (41%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TLGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQA 98
            :|..|....|.|.|.:....::..|.:....::|...||
  Fly     7 SLLSPFKLSLAAQAAMEHTPVLWSHGIDEKAVLFEAGQA 45

Return to query results.
Submit another query.