DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32219 and CG31128

DIOPT Version :9

Sequence 1:NP_730469.1 Gene:CG32219 / 317922 FlyBaseID:FBgn0052219 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_733000.1 Gene:CG31128 / 318601 FlyBaseID:FBgn0051128 Length:166 Species:Drosophila melanogaster


Alignment Length:79 Identity:30/79 - (37%)
Similarity:41/79 - (51%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GFHC-HKDDQNSILRFASDEESAF--AECVPNCFEIKYPIQEYCCFWSPKLGCTILVNEKYFSN- 107
            |..| :|.|:..||...|..|..:  .||||:.:.:..||.::||.|||||||..|.. .|:.| 
  Fly    53 GLFCKNKTDKEKILFSHSLAEKLYNLDECVPHKYNVTGPILDWCCLWSPKLGCQQLAG-IYYQNQ 116

  Fly   108 ---KDLCNNCKYFC 118
               :|.|..|.:.|
  Fly   117 SRWRDTCEICLHSC 130



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.