DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:349 Identity:88/349 - (25%)
Similarity:132/349 - (37%) Gaps:86/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 GNAQSF--SIILNVNSV-PYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQS--- 382
            |||.:.  |.:.||.|. |.||...|..|......|...|....:...|::|:|    .|||   
  Fly    34 GNAGNVGGSTLNNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMH----FEQSAIL 94

  Fly   383 -------TPNPRRTVTDNT--------IRIINLVKGDTGNYGC-----NATNSLGYVYKDVYLNV 427
                   |.|||.:||.:.        :.|.|:.:.|.|.|.|     .|....|:|...|    
  Fly    95 TVHNHVITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVV---- 155

  Fly   428 QAEPPTISEAPAAVSTV--DGRNVTIKCRVNGSPKPLVKWLRASNWLTGGRYNVQANGDLEIQDV 490
               ||.|.:|..:...:  :|.|||::|:..|||:|.:||.|..    |.:  :..|..||:.|:
  Fly   156 ---PPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKWKRDD----GNK--IVINKTLEVHDL 211

  Fly   491 TFSDA-----------GKYTCYAQN-------KFGEIQADGSLVVKEHTRITQEPQNYEVAAGQS 537
            . :|:           |.|.|.|.|       |..::..|.|.:|....::...|..:.:     
  Fly   212 E-TDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNI----- 270

  Fly   538 ATFRC-NEAHDDTLEIEIDWWKDGQSIDFEA----------QPRFVKTNDNSLTIAKTMELDSGE 591
             |..| .||:..:|..   |.::...:..|:          .|.:..|  ..|||......|.|.
  Fly   271 -TLECFIEANPTSLNY---WTRENDQMITESSKYKTETIPGHPSYKAT--MRLTITNVQSSDYGN 329

  Fly   592 YTCVARTRLDEATARANLIVQDVP 615
            |.|||:....:......|.:...|
  Fly   330 YKCVAKNPRGDMDGNIKLYMSSPP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 4/9 (44%)
I-set 339..427 CDD:254352 29/110 (26%)
Ig 354..427 CDD:299845 24/95 (25%)
I-set 432..517 CDD:254352 29/104 (28%)
Ig 446..517 CDD:299845 26/88 (30%)
I-set 522..611 CDD:254352 20/99 (20%)
ig 525..609 CDD:278476 19/94 (20%)
FN3 613..707 CDD:238020 1/3 (33%)
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/99 (25%)
Ig 69..139 CDD:143165 20/73 (27%)
IG_like 165..249 CDD:214653 24/90 (27%)
IGc2 172..237 CDD:197706 23/71 (32%)
IG_like 267..348 CDD:214653 18/91 (20%)
Ig 270..339 CDD:299845 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.