DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and Cntn6

DIOPT Version :10

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_059079.2 Gene:Cntn6 / 53870 MGIID:1858223 Length:1028 Species:Mus musculus


Alignment Length:527 Identity:101/527 - (19%)
Similarity:177/527 - (33%) Gaps:176/527 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AKPKEGQ------PF----PEPLNDFMIKDAATMLFEKPRPNMFMVRCLQWTTVIERTFYAESAE 104
            :||:.|.      ||    .|.:.:|   |:|..|.:     ::|.|..|::.:|:.   .:|.|
Mouse   280 SKPRVGDVLAQLAPFLRMYAEYVKNF---DSAMELLK-----LWMERSTQFSAIIQD---IQSQE 333

  Fly   105 V-----RQRWIHAIESISKKYKGTNANPQEELMETNQQPKIDEDSEFAGAAHAIMGQPSSGHGDN 164
            |     .|.  |.:|.:.:.       |:.|::..:...|:.||.|                 |.
Mouse   334 VCGSLTLQH--HMLEPVQRV-------PRYEMLLKDYLKKLPEDDE-----------------DR 372

  Fly   165 CSIDFRASMISIADT-SEAAKRDKITMEDFDFLKVLGKGTFGKVILCKEKRTQKLYAIKILKKDV 228
            .......::||:|.| |..|.|   .||:.                   |:..::|.:...::|:
Mouse   373 SQAQKSLNIISMAATHSNMAIR---KMENL-------------------KKLMEIYEMLGGEEDI 415

  Fly   229 IIAREEVAHTLTENRVLQRCKHPFLTELKYSFQTNDRLCF-VMEFAIGGDLYYHLNREVQMNKEG 292
            :....|:   :.|.::|:.......:..:|.|..|:.|.: |.:|::.|..:             
Mouse   416 VNPSNEL---IKEGQILKLAARNTSSMERYLFLFNNMLLYCVPKFSLVGQRF------------- 464

  Fly   293 FSEPRARFYGSEIVLALG--YLHANSIVYRDLKLE---NLLLDKDGHIKIADFGLCKEEIS-FGD 351
            ....|.|..|.:::....  |.|...:..::..||   :...||:..||     ..:|.|. |..
Mouse   465 TVRTRVRVEGMKVLETSNEDYPHTFQVSGKERTLELQASSQQDKEDWIK-----AFQETIEIFQQ 524

  Fly   352 KTSTFCGTPEYLAPEVLDDHDYGRCVDWWGVGVVMYEMMCGRLPFYS----KDHNKLFELIMA-- 410
            |..||....:....||..:....|...|.....|...|.| :.||.:    :.|.:....::.  
Mouse   525 KNETFKSACKEATDEVSKEELGKRAPRWIRDNEVTMCMKC-KEPFNALTRRRHHCRACGYVVCYK 588

  Fly   411 -----GDLRFPS----KLSQEARTLLTG--------------------------------LLVKD 434
                 ..||:.|    |:.::...:|||                                |...|
Mouse   589 CSDHKASLRYDSNKLNKVCKDCYHILTGRADAEEPVCGKKKGILEIEAAQVSGNSFLCGFLQYSD 653

  Fly   435 ---PTQR--------------LGGGPEDALEICR--------ADFFRTVDWEATYRKEIEPPYKP 474
               |:||              |.|.|:|...:|.        .|..|:||...|..:..:..|..
Mouse   654 RTKPSQRVWCVIPQHDALVLYLYGAPQDVKALCTIPLLGYQVEDVQRSVDHPPTGFRLCQSKYIH 718

  Fly   475 NVQSETD 481
            ...:||:
Mouse   719 CFTAETE 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 29..128 CDD:472250 20/92 (22%)
Ig strand B 55..59 CDD:409353 3/13 (23%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 1/4 (25%)
Ig strand G 122..125 CDD:409353 0/2 (0%)
Ig 137..216 CDD:472250 15/79 (19%)
Ig strand B 151..155 CDD:409353 0/3 (0%)
Ig strand C 165..169 CDD:409353 0/3 (0%)
Ig strand E 192..196 CDD:409353 0/3 (0%)
Ig strand F 209..214 CDD:409353 0/4 (0%)
ig 251..332 CDD:395002 15/86 (17%)
Ig strand B 264..268 CDD:409353 1/3 (33%)
Ig strand C 277..281 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 0/4 (0%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 20/103 (19%)
Ig strand A 339..342 CDD:409570 0/2 (0%)
Ig strand A' 348..351 CDD:409570 1/3 (33%)
Ig strand B 356..363 CDD:409570 1/6 (17%)
Ig strand C 369..374 CDD:409570 0/4 (0%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/3 (33%)
Ig strand E 393..397 CDD:409570 1/3 (33%)
Ig strand F 406..414 CDD:409570 0/14 (0%)
Ig strand G 417..427 CDD:409570 2/13 (15%)
Ig 446..517 CDD:472250 9/44 (20%)
Ig strand B 449..453 CDD:409358 1/11 (9%)
Ig strand C 462..466 CDD:409358 1/3 (33%)
Ig strand E 483..487 CDD:409358
Ig strand F 497..502 CDD:409358
Ig strand G 510..513 CDD:409358
Ig 521..615 CDD:472250
Ig strand B 538..542 CDD:409353
Ig strand C 553..557 CDD:409353
Ig strand E 577..581 CDD:409353
Ig strand F 591..596 CDD:409353
Ig strand G 604..607 CDD:409353
FN3 613..707 CDD:238020
FN3 683..>1051 CDD:442628
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
Cntn6NP_059079.2 Ig 26..120 CDD:472250
Ig strand B 46..50 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 97..102 CDD:409353
Ig strand G 111..114 CDD:409353
Ig 129..214 CDD:472250
Ig strand B 140..144 CDD:409353
Ig strand C 154..158 CDD:409353
Ig strand E 179..183 CDD:409353
Ig strand F 193..198 CDD:409353
Ig strand G 209..212 CDD:409353
Ig 227..315 CDD:472250 10/42 (24%)
Ig strand B 245..249 CDD:409353
Ig strand C 258..262 CDD:409353
Ig strand E 280..284 CDD:409353 2/3 (67%)
Ig strand F 294..299 CDD:409353 1/4 (25%)
Ig strand G 307..310 CDD:409353 1/2 (50%)
Ig 319..403 CDD:472250 25/134 (19%)
Ig strand B 335..339 CDD:143205 0/3 (0%)
Ig strand C 348..352 CDD:143205 0/10 (0%)
Ig strand E 369..373 CDD:143205 2/20 (10%)
Ig strand F 383..388 CDD:143205 2/4 (50%)
Ig strand G 396..399 CDD:143205 2/2 (100%)
Ig5_Contactin 408..496 CDD:409358 16/103 (16%)
Ig strand A 408..413 CDD:409358 0/4 (0%)
Ig strand A' 416..421 CDD:409358 0/4 (0%)
Ig strand B 425..432 CDD:409358 2/6 (33%)
Ig strand C 440..444 CDD:409358 1/3 (33%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 0/17 (0%)
Ig strand F 475..483 CDD:409358 0/7 (0%)
Ig strand G 489..496 CDD:409358 0/6 (0%)
Ig 500..598 CDD:472250 21/103 (20%)
Ig strand B 517..521 CDD:409353 2/3 (67%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
Ig strand F 574..579 CDD:409353 1/4 (25%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
FN3 598..691 CDD:238020 15/92 (16%)
FN3 <620..>912 CDD:442628 18/106 (17%)
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.