Sequence 1: | NP_001245581.1 | Gene: | Nrg / 31792 | FlyBaseID: | FBgn0264975 | Length: | 1309 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
Alignment Length: | 327 | Identity: | 81/327 - (24%) |
---|---|---|---|
Similarity: | 125/327 - (38%) | Gaps: | 73/327 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 SPTVNWMIQESI----------------------------------DGSIKSINNSRMTL--DPE 191
Fly 192 GN---LWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSR 253
Fly 254 RQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCD 318
Fly 319 VSNGVGNAQSFSIILNVNSVPYFT-KEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQS 382
Fly 383 TPNPRRTV---------TDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYL---NVQAEPPTIS 435
Fly 436 EA 437 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nrg | NP_001245581.1 | Ig | 55..128 | CDD:299845 | |
IG_like | 57..127 | CDD:214653 | |||
Ig | 135..214 | CDD:299845 | 18/89 (20%) | ||
IG_like | 141..216 | CDD:214653 | 18/91 (20%) | ||
ig | 251..332 | CDD:278476 | 22/80 (28%) | ||
I-set | 339..427 | CDD:254352 | 28/100 (28%) | ||
Ig | 354..427 | CDD:299845 | 24/84 (29%) | ||
I-set | 432..517 | CDD:254352 | 2/6 (33%) | ||
Ig | 446..517 | CDD:299845 | |||
I-set | 522..611 | CDD:254352 | |||
ig | 525..609 | CDD:278476 | |||
FN3 | 613..707 | CDD:238020 | |||
FN3 | 716..807 | CDD:238020 | |||
fn3 | 817..905 | CDD:278470 | |||
FN3 | 917..1004 | CDD:238020 | |||
FN3 | 1041..1111 | CDD:238020 | |||
Bravo_FIGEY | 1155..>1221 | CDD:290593 | |||
Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 20/99 (20%) |
FR1 | 37..50 | CDD:409353 | 2/12 (17%) | ||
Ig strand A' | 37..42 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 44..51 | CDD:409353 | 0/6 (0%) | ||
CDR1 | 51..59 | CDD:409353 | 0/7 (0%) | ||
Ig strand C | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 60..63 | CDD:409353 | 0/2 (0%) | ||
CDR2 | 67..81 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 68..72 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
FR3 | 84..115 | CDD:409353 | 9/33 (27%) | ||
Ig strand D | 84..90 | CDD:409353 | 2/5 (40%) | ||
Ig strand E | 94..102 | CDD:409353 | 1/7 (14%) | ||
Ig strand F | 108..115 | CDD:409353 | 3/9 (33%) | ||
CDR3 | 116..124 | CDD:409353 | 2/7 (29%) | ||
FR4 | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig strand G | 124..130 | CDD:409353 | 1/5 (20%) | ||
Ig_3 | 134..208 | CDD:404760 | 22/75 (29%) | ||
Ig strand B | 153..157 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 166..170 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 201..206 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
Ig | 227..318 | CDD:416386 | 26/94 (28%) | ||
Ig strand C | 256..260 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12231 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |