DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and DIP-theta

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:364 Identity:93/364 - (25%)
Similarity:137/364 - (37%) Gaps:76/364 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 VNSV-----PYFTKEPEIATAAEDEEVVFECRAAGVPEPKISW----------IHNGKPIEQSTP 384
            ||::     |.|.:..:..|.....|.|.:|....:...||:|          |.|    ...|.
  Fly   121 VNAIPEKDLPKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQN----HVITK 181

  Fly   385 NPRRTVTDN-----TIRIINLVKGDTGNYGCNAT-----NSLGYVYKDVYLNVQAEPPTISEAPA 439
            |.|.::|..     .:||.::.:.|.|.|.|...     :.:||:  ||.:     ||.|.:.|.
  Fly   182 NHRMSITHAEKRAWILRIRDVKESDKGWYMCQINTDPMKSQVGYL--DVVV-----PPDILDYPT 239

  Fly   440 AVSTV--DGRNVTIKCRVNGSPKPLVKWLRASNW---LTGGRYNVQANGD-LEIQDVTFSDAGKY 498
            :...|  :|.|||:||...|||.|.:.|.|....   |..|...|..||. |.|..|...:.|.|
  Fly   240 STDMVIREGSNVTLKCAATGSPTPTITWRREGGELIPLPNGAEAVAYNGSFLTIAKVNRLNMGAY 304

  Fly   499 TCYAQNKF-GEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRC-NEAHDDTLEIEIDWWKDGQ 561
            .|.|.|.. ..:.....|:|.....|..:.|....|..|:.|..| :||:..:    |::|....
  Fly   305 LCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKS----INYWMKND 365

  Fly   562 SIDFEAQPRFVKTNDNS-------LTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAPK 619
            :|....: |||.....|       |||.:....|.|.|.|||:..|.:......|.     :.|:
  Fly   366 TIIVPGE-RFVPETFESGYKITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLY-----HIPQ 424

  Fly   620 LTGITCQA---------------DKAEIHWEQQGDNRSP 643
            .|.:|..|               :|.:.:...|..|.:|
  Fly   425 TTTMTTMAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNP 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476
I-set 339..427 CDD:254352 25/107 (23%)
Ig 354..427 CDD:299845 22/92 (24%)
I-set 432..517 CDD:254352 30/91 (33%)
Ig 446..517 CDD:299845 26/75 (35%)
I-set 522..611 CDD:254352 26/96 (27%)
ig 525..609 CDD:278476 24/91 (26%)
FN3 613..707 CDD:238020 8/46 (17%)
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 23/98 (23%)
IG_like 137..230 CDD:214653 23/98 (23%)
IG_like 240..324 CDD:214653 27/83 (33%)
IGc2 247..310 CDD:197706 24/62 (39%)
Ig 327..419 CDD:299845 25/96 (26%)
IG_like 343..420 CDD:214653 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.