DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and DIP-beta

DIOPT Version :10

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:305 Identity:77/305 - (25%)
Similarity:120/305 - (39%) Gaps:82/305 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GTPLPQTV-WSKDGQR---------IQWSDRITQGH--YGK-SLVIRQTNFDDAGTYTCDVSNGV 323
            |:..|..| |.|...:         |..:||::..|  |.. :|.||....:|||.|.|.|:...
  Fly   133 GSSAPAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDP 197

  Fly   324 GNAQSFSIILNVNSVPYFTKE--------PEIATAAEDEEVVFECRAAGVPEPKISW-IHNGKPI 379
            ...|:.:  |.|...|....|        ||..:|.      ..|||.|.|:|||:| ..:|:.|
  Fly   198 MKMQTAT--LEVVI
PPDIINEETSGDMMVPEGGSAK------LVCRARGHPKPKITWRREDGREI 254

  Fly   380 EQSTPNPRRT----VTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTIS----- 435
            .....:.::|    |....:.:..:.:.:.|.|.|.|:|.:              |||:|     
  Fly   255 IARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGV--------------PPTVSKRMKL 305

  Fly   436 --------EAP-----AAVSTVDGRNVTIKCRVNGSPKPLVKWLRASN--WLTGGRYNVQANGD- 484
                    :.|     |.|.|    :||:.|.|..|||.:..|.|.:.  .:.|.||.:....: 
  Fly   306 QVHFHPLVQVPNQLVGAPVLT----DVTLICNVEASPKAINYWQRENGEMIIAGDRYALTEKENN 366

  Fly   485 -------LEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTR 522
                   |.|:.:..||.|.|.|.::|..|:  .:|::.:.|..|
  Fly   367 MYAIEMILHIKRLQSSDFGGYKCISKNSIGD--TEGTIRLYEMER 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002 20/72 (28%)
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353 1/4 (25%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 314..319 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 23/100 (23%)
Ig strand A 339..342 CDD:409570 1/2 (50%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 2/6 (33%)
Ig strand C 369..374 CDD:409570 3/5 (60%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/7 (14%)
Ig strand E 393..397 CDD:409570 0/3 (0%)
Ig strand F 406..414 CDD:409570 4/7 (57%)
Ig strand G 417..427 CDD:409570 0/9 (0%)
Ig 446..517 CDD:472250 22/80 (28%)
Ig strand B 449..453 CDD:409358 2/3 (67%)
Ig strand C 462..466 CDD:409358 0/3 (0%)
Ig strand E 483..487 CDD:409358 1/11 (9%)
Ig strand F 497..502 CDD:409358 2/4 (50%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 1/2 (50%)
Ig strand B 538..542 CDD:409353
Ig strand C 553..557 CDD:409353
Ig strand E 577..581 CDD:409353
Ig strand F 591..596 CDD:409353
Ig strand G 604..607 CDD:409353
FN3 613..707 CDD:238020
FN3 683..>1051 CDD:442628
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 22/77 (29%)
Ig strand B 115..119 CDD:409353
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 1/3 (33%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 0/4 (0%)
Ig 211..307 CDD:472250 27/115 (23%)
Ig strand B 230..234 CDD:409353 1/9 (11%)
Ig strand C 243..247 CDD:409353 2/3 (67%)
Ig strand E 272..276 CDD:409353 0/3 (0%)
Ig strand F 286..291 CDD:409353 2/4 (50%)
Ig strand G 300..303 CDD:409353 1/2 (50%)
IG_like 327..405 CDD:214653 22/79 (28%)
Ig strand B 328..332 CDD:409353 2/3 (67%)
Ig strand C 341..346 CDD:409353 1/4 (25%)
Ig strand E 365..376 CDD:409353 1/10 (10%)
Ig strand F 386..391 CDD:409353 2/4 (50%)
Ig strand G 399..402 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.