DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and DIP-alpha

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:332 Identity:75/332 - (22%)
Similarity:130/332 - (39%) Gaps:80/332 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 GQRIQW------------------SDRITQGHYGK---SLVIRQTNFDDAGTYTCDVSNGVGNAQ 327
            |.|:.|                  :.|:|..|..:   :|.|:..:.:|.|.|.|.::.....:|
  Fly    70 GYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQ 134

  Fly   328 -SFSIILNVNSVPYFTKEPEIA--TAAEDEEVVFECRAAGVPEPKISW-IHNGKPIEQSTPNPRR 388
             .|   |:|...|.|..|...:  ...|...|...|||.|.|||.::| ..:|..|........:
  Fly   135 IGF---LDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTK 196

  Fly   389 TVTDN----TIRIINLVKGDTGNYGCNATNSL-GYVYKDVYLNVQAEPPTISEAP-AAVSTVDGR 447
            |:..:    .:::..:.:.:.|:|.|.|:|.: ..|.|.:.|::...|  :.:.| ..|....|.
  Fly   197 TLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHP--VIQVPNQLVGAPLGT 259

  Fly   448 NVTIKCRVNGSPKPLVKWLRASNWL--TGGRYNVQANG--------DLEIQDVTFSDAGKYTCYA 502
            :|.|:|.|..|||.:..|::.:..:  |.|:|:||.:.        .:.::.....|.|.|.|.|
  Fly   260 DVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIA 324

  Fly   503 QNKFGEIQ--------------------------ADGSLVV--------KEHTRITQEPQNYEVA 533
            :|..||:.                          |.|||..        |:..::|.:|::.|:.
  Fly   325 KNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQ 389

  Fly   534 AGQSATF 540
            .|....|
  Fly   390 YGSVEDF 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 14/69 (20%)
I-set 339..427 CDD:254352 24/95 (25%)
Ig 354..427 CDD:299845 20/78 (26%)
I-set 432..517 CDD:254352 28/121 (23%)
Ig 446..517 CDD:299845 26/106 (25%)
I-set 522..611 CDD:254352 5/19 (26%)
ig 525..609 CDD:278476 4/16 (25%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 12/58 (21%)
Ig 51..131 CDD:299845 12/60 (20%)
I-set 144..240 CDD:254352 24/95 (25%)
IGc2 159..228 CDD:197706 18/68 (26%)
Ig 244..337 CDD:299845 25/94 (27%)
I-set 244..337 CDD:254352 25/94 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.