DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and oig-5

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_001023534.1 Gene:oig-5 / 259604 WormBaseID:WBGene00023520 Length:164 Species:Caenorhabditis elegans


Alignment Length:134 Identity:37/134 - (27%)
Similarity:58/134 - (43%) Gaps:14/134 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKH------PPVRQYVSRRQSLALRGKRM 264
            ||.||.|:|.::...:||.||       |..:..:.||.      .|..||::|...:|.:|...
 Worm    33 SDRYYTCTAENIRLKDYKSGN-------QFSLQITNNKRRSLQQTTPTEQYLNRSSPIAEQGNLH 90

  Fly   265 ELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSF 329
            :|.|.:...|:|...|..:|..|...........|.:||...|. |.||.|.|..:......:||
 Worm    91 KLHCFFSAYPVPIPRWFHNGSEINEDKGYRFESNGNTLVFNATQ-DKAGKYDCRFATKQDIDRSF 154

  Fly   330 SIIL 333
            ::::
 Worm   155 NVVV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845 5/7 (71%)
IG_like 141..216 CDD:214653 6/9 (67%)
ig 251..332 CDD:278476 21/80 (26%)
I-set 339..427 CDD:254352
Ig 354..427 CDD:299845
I-set 432..517 CDD:254352
Ig 446..517 CDD:299845
I-set 522..611 CDD:254352
ig 525..609 CDD:278476
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
oig-5NP_001023534.1 Ig 87..143 CDD:386229 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3513
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208655at33208
OrthoFinder 1 1.000 - - FOG0000777
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.