DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and Cntn3

DIOPT Version :10

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_032805.2 Gene:Cntn3 / 18488 MGIID:99534 Length:1028 Species:Mus musculus


Alignment Length:1057 Identity:303/1057 - (28%)
Similarity:474/1057 - (44%) Gaps:103/1057 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WRQSTILA---ALLVALLCAGSAESKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADG 63
            |:|..:|:   .|...||..|         |...|:|:  ..:|.|..::|:    ..:.|||.|
Mouse     5 WKQLILLSFIGCLAGELLLQG---------PVFIKEPS--NSIFPVDSEDKK----ITLNCEARG 54

  Fly    64 QPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVR 128
            .|.|.|.|..||...| .:.|:| .:..|...:||...::.|.|.|||||:|..||..|....::
Mouse    55 NPSPHYRWQLNGSDID-TSLDHR-YKLNGGNLIVINPNRNWDTGSYQCFATNSLGTIVSREAKLQ 117

  Fly   129 KAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGN 193
            .|.|..||.....|:...||:..:|.|..|......:..|:..|.  .|....::.|......|:
Mouse   118 FAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVFNEY--PSFVEEDSRRFVSQETGH 180

  Fly   194 LWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLA 258
            |:.:.|...|..:   |.|..||...:...:|:...|.::..||   ..::.|..:........|
Mouse   181 LYIAKVEPSDVGN---YTCVVTSTVTNTRVLGSPTPLVLRSDGV---MGEYEPKIEVQFPETLPA 239

  Fly   259 LRGKRMELFCIYGGTPLPQTVWSK-DGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNG 322
            .:|..:.|.|...|.|:||..|.: ||  :.:.::|....:...|.|:....:|.|:|.|...|.
Mouse   240 AKGSTVRLECFALGNPVPQINWRRSDG--MPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENS 302

  Fly   323 VGNAQSFSIILNV--NSVPYFTK--------EPEIATAAEDEEVVFECRAAGVPEPKISWIHNGK 377
            .|.        ||  ..:.|:.|        :.|||.   ::.:.:||||:|.|:|...|:.||.
Mouse   303 RGK--------NVARGRLTYYAKPYWLQLLRDVEIAV---EDSLYWECRASGKPKPSYRWLKNGD 356

  Fly   378 PIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAP--AA 440
            .:   ....|..:.:..:.|.||...|:|.:.|.|.|..|.:|....|.|.|..|..|..|  ..
Mouse   357 AL---VLEERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAELKVVASAPDFSRNPMKKM 418

  Fly   441 VSTVDGRNVTIKCRVNGSPKPLVKWLRASNWL-TGGRYNVQANGDLEIQDVTFSDAGKYTCYAQN 504
            |....|..|.:.|:...||:.|..|.:....: ...|.:...:|.|:|.:||.:|||.|||.|:|
Mouse   419 VQVQVGSLVILDCKPRASPRALSFWKKGDMMVREQARVSFLNDGGLKIMNVTKADAGTYTCTAEN 483

  Fly   505 KFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEAQ- 568
            :||:......|||.|.|||...|.|.:||.|:|....|...||..|:|...|:.:|...||:.. 
Mouse   484 QFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGALTDFKKDG 548

  Fly   569 PRFVKTNDNS---LTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAP---KLTGITCQA 627
            ..|.|...:|   |.|.......||:|.|:.:|.:|..::.|.|||:..|..|   |:..||  .
Mouse   549 SHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAELIVRGSPGPPENVKVDEIT--D 611

  Fly   628 DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVP-----NTDSSFVVQMSPWANYTFR 687
            ..|::.|.:..|:.||::.|.:|..|.|: ..|.:. ..||     .|.::.||:::||..|.||
Mouse   612 TTAQLSWTEGTDSHSPVISYAVQARTPFS-VGWQSV-RTVPEVIDGKTHTATVVELNPWVEYEFR 674

  Fly   688 VIAFNKIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVS 752
            ::|.||||...||..|:...|:...|...|..|.|.|...:.|||:|.|:||...|...|.|.|:
Mouse   675 IVASNKIGGGEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVITWDPVPEELQNGGGFGYVVA 739

  Fly   753 WKRDIPAAAW-------ENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGYS 810
            : |.:....|       .:|..:.:|..:||     .|..|.:||...|::||...:....| :|
Mouse   740 F-RPLGVTTWIQTVVTSPDNPRYVFRNESIV-----PFSPYEVKVGVYNNKGEGPFSPVTTV-FS 797

  Fly   811 GEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTWTENEGEEGLREIHVKGDT 875
            .|:.|..||::.:...::||.. .::|..:..:...||..||:::.|.....||..|::.|.|:.
Mouse   798 AEEEPTVAPSHISAHSLSSSEI-EVSWNTIPWKLSNGHLLGYEVRYWNNGGEEESSRKVKVAGNQ 861

  Fly   876 HNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWK-- 938
            .:|::...|.:...|..:.|||....||.||.::..|.:..||...|...:....:..:|:|:  
Mouse   862 TSAVLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKKTPPSQPPGNVVWNATDTKVLLNWEQV 926

  Fly   939 KPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGE 1003
            |.:....::||||::|....::.|        |:.:...|..::. |.....|.|.:.|||..|:
Mouse   927 KAMENESEVTGYKVFYRTSSQNNV--------HVLNTNKTSAELL-LPIKEDYIIEVKATTDGGD 982

  Fly  1004 G--SEHY-IEKTTLKDA 1017
            |  ||.. |.:.|..||
Mouse   983 GTSSEQIRIPRITSMDA 999

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 29..128 CDD:472250 33/98 (34%)
Ig strand B 55..59 CDD:409353 0/3 (0%)
Ig strand C 68..72 CDD:409353 1/3 (33%)
Ig strand E 94..98 CDD:409353 0/3 (0%)
Ig strand F 108..113 CDD:409353 3/4 (75%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 137..216 CDD:472250 16/78 (21%)
Ig strand B 151..155 CDD:409353 1/3 (33%)
Ig strand C 165..169 CDD:409353 0/3 (0%)
Ig strand E 192..196 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 2/4 (50%)
ig 251..332 CDD:395002 20/81 (25%)
Ig strand B 264..268 CDD:409353 1/3 (33%)
Ig strand C 277..281 CDD:409353 1/3 (33%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 27/95 (28%)
Ig strand A 339..342 CDD:409570 1/2 (50%)
Ig strand A' 348..351 CDD:409570 1/2 (50%)
Ig strand B 356..363 CDD:409570 3/6 (50%)
Ig strand C 369..374 CDD:409570 1/4 (25%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/3 (33%)
Ig strand E 393..397 CDD:409570 0/3 (0%)
Ig strand F 406..414 CDD:409570 3/7 (43%)
Ig strand G 417..427 CDD:409570 3/9 (33%)
Ig 446..517 CDD:472250 24/71 (34%)
Ig strand B 449..453 CDD:409358 1/3 (33%)
Ig strand C 462..466 CDD:409358 1/3 (33%)
Ig strand E 483..487 CDD:409358 2/3 (67%)
Ig strand F 497..502 CDD:409358 3/4 (75%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 33/97 (34%)
Ig strand B 538..542 CDD:409353 0/3 (0%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 2/6 (33%)
Ig strand F 591..596 CDD:409353 2/4 (50%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 33/101 (33%)
FN3 683..>1051 CDD:442628 99/347 (29%)
fn3 817..905 CDD:394996 23/87 (26%)
fn3 918..1007 CDD:394996 22/92 (24%)
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
Cntn3NP_032805.2 Ig 25..120 CDD:472250 34/111 (31%)
Ig strand B 46..50 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 82..86 CDD:409353 0/3 (0%)
Ig strand F 97..102 CDD:409353 3/4 (75%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..214 CDD:472250 19/89 (21%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..198 CDD:409353 2/7 (29%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 23/97 (24%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 1/2 (50%)
Ig 320..403 CDD:472250 25/88 (28%)
Ig strand B 335..339 CDD:409353 0/3 (0%)
Ig strand C 348..352 CDD:409353 0/3 (0%)
Ig strand E 369..373 CDD:409353 0/3 (0%)
Ig strand F 383..388 CDD:409353 1/4 (25%)
Ig strand G 396..399 CDD:409353 1/2 (50%)
Ig 408..496 CDD:472250 28/87 (32%)
Ig strand B 427..431 CDD:409353 1/3 (33%)
Ig strand C 440..444 CDD:409353 1/3 (33%)
Ig strand E 462..466 CDD:409353 2/3 (67%)
Ig strand F 476..481 CDD:409353 3/4 (75%)
Ig strand G 489..492 CDD:409353 0/2 (0%)
Ig 498..598 CDD:472250 34/99 (34%)
Ig strand B 517..521 CDD:409353 0/3 (0%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 1/3 (33%)
Ig strand F 574..579 CDD:409353 2/4 (50%)
FN3 579..>1006 CDD:442628 127/442 (29%)
Ig strand G 587..590 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..714 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.