DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and IL31RA

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:NP_620586.3 Gene:IL31RA / 133396 HGNCID:18969 Length:764 Species:Homo sapiens


Alignment Length:584 Identity:114/584 - (19%)
Similarity:202/584 - (34%) Gaps:158/584 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 VTFSDAGKYTCYAQNKFGEIQAD-GSLVVKEHTRI--------TQEPQNYEVAAGQSATFRCNEA 545
            :|..|  .||.       |::|: |..|:|.|...        |:.|:          .||....
Human   120 ITIPD--NYTI-------EVEAENGDGVIKSHMTYWRLENI
AKTEPPK----------IFRVKPV 165

  Fly   546 HDDTLEIEIDWWKD---GQSIDFEAQPRFVKTNDNS---LTIAK-------TMELDS----GEYT 593
            ......|:|:|.|.   ..|.|.:...||...|..|   :..||       |..|..    .||.
Human   166 LGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYV 230

  Fly   594 CVARTRLDE-------ATARANLIVQDVPNAPKLTGI--TCQAD---KAEIHWEQQGDNRSPILH 646
            ...|..:.|       :..:..:..::.|...:|..:  ..:||   ...:.|::.  ..:|:|.
Human   231 IALRCAVKESKFWSDWSQEKMGMT
EEEAPCGLELWRVLKPAEADGRRPVRLLWKKA--RGAPVLE 293

  Fly   647 YTIQFNTSFTPASWDAAYEKVPNTDSSFVVQM---SPWANYTFRVIAFNKIGASP------PSAH 702
            .|:.:|..:.|.|.....|.:..|:....:.:   |.|.:    :|::|.:|.||      |:..
Human   294 KTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVS----MISYNSLGKSPVATLRIPAIQ 354

  Fly   703 SDS---------CTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIP 758
            ..|         |..:..:..|...:.:    :.|..:|.|.|..:.|...      :||:....
Human   355 EKSFQCIEVMQACVAEDQLVVKWQSSAL----DVNTWMIEWFPDVDSEPTT------LSWESVSQ 409

  Fly   759 AAAWENNNIFDWRQNNIVIADQPTFVKYLIKVV-AINDR-GESNVAAEEVVGYSGEDRPLDAP-- 819
            |..|      ..:|:.:    :| |..|.|.|. .::|: ||    ...:..|:.|..|.:.|  
Human   410 ATNW------TIQQDKL----KP-FWCYNISVYPMLHDKVGE----PYSIQAYAKEGVPSEGPET 459

  Fly   820 --TNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTWTENEGEEGLREIHVKGDTHNALVTQ 882
              .|..::.:|      :.|..:.:...:|....|.|  :.:.||.:|..:      |.|:.:.|
Human   460 KVENIGVKTVT------ITWKEIPKSERKGIICNYTI--FYQAEGGKGFSK------TVNSSILQ 510

  Fly   883 F-----KPDSKNYARILAYN--GRFNGPPSAVIDFDTPEG-------VPSPVQG--------LDA 925
            :     |..:....:::|..  |..||   ..|:|.|...       :.|.:.|        ..|
Human   511 YGLESLKRKTSYIVQVMASTSAGGTNG---TSINFKTLSFSVFEIILITSLIGGGLLILIILTVA 572

  Fly   926 YPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNS 989
            |.|.....:.|...|..||...:....::.:..:..:..:...|...|:.|:       |||.|
Human   573 YGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRI-------LKPCS 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476
I-set 339..427 CDD:254352
Ig 354..427 CDD:299845
I-set 432..517 CDD:254352 7/27 (26%)
Ig 446..517 CDD:299845 7/27 (26%)
I-set 522..611 CDD:254352 22/120 (18%)
ig 525..609 CDD:278476 21/107 (20%)
FN3 613..707 CDD:238020 22/116 (19%)
FN3 716..807 CDD:238020 18/92 (20%)
fn3 817..905 CDD:278470 18/98 (18%)
FN3 917..1004 CDD:238020 16/81 (20%)
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
IL31RANP_620586.3 FN3 57..151 CDD:304408 10/39 (26%)
FN3 155..254 CDD:238020 21/108 (19%)
FN3 453..533 CDD:214495 16/93 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.