DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and ncam1b

DIOPT Version :10

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:XP_009289824.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1054 Species:Danio rerio


Alignment Length:1074 Identity:222/1074 - (20%)
Similarity:361/1074 - (33%) Gaps:347/1074 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 SLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGV 365
            :|.|.....|:||||.|..|:|..:|:: ::.|.:.....||..|......|.:..:..|.....
Zfish    78 TLTIYNAKVDNAGTYRCVASSGDQDAEA-TVNLKIYQKITFTNVPSPQEFTEGDNAIIVCDVISS 141

  Fly   366 PEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGC----NATNSLGYVYKDVYLN 426
            |.|.:.|.:.|..|:.......:|:::|.::|..:.|.|.|.|.|    .|...:.:....|.:|
Zfish   142 PPPTVLWKYKGAKIQFDKDVRFKTLSNNHLQIRGIRKTDEGVYTCEGRIKARGEVDFRSIKVVVN 206

  Fly   427 VQAEPPTISEAPAAV-STVD-GRNVTIKCRVNGSPKPLVKWLRASNWL-TGGRYNVQANG-DLEI 487
            |.   |||....|.. :|.| |.:..:.|..:|.|:|:|.|.|.:..| :|.:|:...:| ::.:
Zfish   207 VL---PTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNKYSFNEDGSEMTV 268

  Fly   488 QDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEI 552
            .|||..|.|.|||.|:||.||.:.:.||.|....:||...........:..|..|....|.|..|
Zfish   269 LDVTKLDEGDYTCIAKNKAGESEQELSLKVFVQPKITYLESQTTTEMDEQVTLTCEATGDPTPTI 333

  Fly   553 EIDWWKDGQSI----DFEAQPRFVKTN---------------------DNSLTIAKTMELDSGEY 592
            .   |..|..:    :.|.|.|..:.:                     .:|||:......|:|:|
Zfish   334 T---WSFGTRVFTEGEQEQQKRIYQASWTRPEQHKGPDGEVLVRSDARVSSLTLKYPQYTDAGQY 395

  Fly   593 TCVARTRLDEATARANLIVQDVPNAPKLTGITCQADKAEIHWEQQGDNRSPILHYTIQFNTSFTP 657
            .|.||..:.|.....:|   :|..|||:.|     ..|...||....|    :...:..:.|...
Zfish   396 LCTARNAIGETVQPVSL---EVRYAPKILG-----SVAVYTWEGNPAN----ISCEVLAHPSDVS 448

  Fly   658 ASWDAAYEKVPNTDSSFV-VQMSPWANYTFRVIAFNKIGASPPSAHSD----SCTTQPDVPFKNP 717
            .:|.....::||.::|.: :..:|.|:|    :..|      |.:.||    :|||..::     
Zfish   449 ITWLRDGFQLPNANTSNIKIHNTPSASY----LEVN------PESQSDFGNYNCTTSNEI----- 498

  Fly   718 DNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDIPAAAWENNNIFDWRQNNIVIADQPT 782
                  |||....::    :|                .|:|:|                    |:
Zfish   499 ------GTESREFIM----IP----------------ADVPSA--------------------PS 517

  Fly   783 FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRG 847
            .                           ||.:|..:.......: ..||.|    .||.:     
Zfish   518 I---------------------------GEVQPYSSTAQVLFEE-PESTGG----VPVLK----- 545

  Fly   848 HFKGYKIQTWTENEGEEGLREIHVKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDT 912
                |:.:......|:...|...||....:..||..||::....::.|.||:..|..|..:.|.|
Zfish   546 ----YRAEWRAVGRGKWVQRVYEVKDGLSSVTVTGLKPETDYEVKMSAINGKGEGDSSPSMVFKT 606

  Fly   913 PEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRV 977
                                                      |.|:.||.               
Zfish   607 ------------------------------------------EHVRYSYT--------------- 614

  Fly   978 TRMKMAGLKPNSKYRISITATTKMGEGSEHYIEKTTLKDAVNVAPATPSFSWEQLPSDNGLAKFR 1042
                                     .|..|:..:.|.:      |:.|.......|..|.|   :
Zfish   615 -------------------------NGIFHFHTEDTGE------PSPPILEGTLQPKGNSL---K 645

  Fly  1043 INWLPSTE-GHPGTHFFTMHRIKGETQWIRE-NEEKNSDYQEVGGLDPETAYEFRVVSVDGH--- 1102
            :.|:...: |.|.||:...::.:.:::|..| .....|:|..:.|||.:|.|:..||:.:..   
Zfish   646 VKWIKQDDGGSPITHYLVRYKAREDSEWKPEIRLPSGSEYVMLIGLDWDTEYDVFVVAENQQGKS 710

  Fly  1103 ------FNTESATQEIDTNTVEGPIMVANETVANAGWFIGMMLALAFIIILF------------I 1149
                  |.|.|.......:..:||.:       |.|..:|:::.:..:::|.            |
Zfish   711 KPGTLTFRTSSEPTATTDSMEDGPGL-------NTGVIVGILILVCVLLLLIVDATCCFLNKCGI 768

  Fly  1150 IICIIRRNRGGK--YDVHDRELANGRRDYPEEGGFHEYSQPLDNKSAGRQSVSSANKPGVESDTD 1212
            ::||.     ||  .....:::..|                   |:|..|.||  .:|.||..|:
Zfish   769 LMCIC-----GKPGQSTKGKDIETG-------------------KAAFVQDVS--KEPIVEVRTE 807

  Fly  1213 SMAEYGDGDTAVATAAARAAAAARSKLTSLPTSTQQQQQQQQQQQQQQEQPQSTSASTVPL---- 1273
            ..|      ||...|.........:.||                  :.||...|:|:.|.|    
Zfish   808 EEA------TANHDAEGHLEPNETTPLT------------------EPEQVTETAAAVVDLPLSV 848

  Fly  1274 ----------ISLASPSP-SPSSTSNSPTAAPPS 1296
                      ..|:..|| |.|:|..|...||||
Zfish   849 PTNSDTITDTFDLSQSSPVSESTTLTSSITAPPS 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002 11/30 (37%)
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 3/4 (75%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
IgI_4_hemolin-like 339..427 CDD:409570 20/91 (22%)
Ig strand A 339..342 CDD:409570 0/2 (0%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 1/6 (17%)
Ig strand C 369..374 CDD:409570 1/4 (25%)
Ig strand C' 377..379 CDD:409570 0/1 (0%)
Ig strand D 387..391 CDD:409570 1/3 (33%)
Ig strand E 393..397 CDD:409570 1/3 (33%)
Ig strand F 406..414 CDD:409570 4/11 (36%)
Ig strand G 417..427 CDD:409570 1/9 (11%)
Ig 446..517 CDD:472250 27/72 (38%)
Ig strand B 449..453 CDD:409358 0/3 (0%)
Ig strand C 462..466 CDD:409358 1/3 (33%)
Ig strand E 483..487 CDD:409358 1/4 (25%)
Ig strand F 497..502 CDD:409358 3/4 (75%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 23/118 (19%)
Ig strand B 538..542 CDD:409353 1/3 (33%)
Ig strand C 553..557 CDD:409353 0/3 (0%)
Ig strand E 577..581 CDD:409353 2/3 (67%)
Ig strand F 591..596 CDD:409353 2/4 (50%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 21/98 (21%)
FN3 683..>1051 CDD:442628 53/372 (14%)
fn3 817..905 CDD:394996 18/87 (21%)
fn3 918..1007 CDD:394996 5/88 (6%)
FN3 1041..1111 CDD:238020 19/80 (24%)
Bravo_FIGEY 1155..>1221 CDD:464016 13/67 (19%)
ncam1bXP_009289824.1 Ig 20..113 CDD:472250 12/35 (34%)
Ig strand B 37..41 CDD:409353
Ig strand C 49..53 CDD:409353
Ig strand E 77..81 CDD:409353 1/2 (50%)
Ig strand F 91..96 CDD:409353 3/4 (75%)
Ig strand G 104..107 CDD:409353 0/3 (0%)
Ig 117..186 CDD:472250 17/68 (25%)
Ig strand B 132..136 CDD:409353 0/3 (0%)
Ig strand C 145..149 CDD:409353 0/3 (0%)
Ig strand E 169..173 CDD:409353 1/3 (33%)
Ig strand F 183..188 CDD:409353 2/4 (50%)
Ig strand G 198..201 CDD:409353 0/2 (0%)
Ig 208..301 CDD:472250 34/95 (36%)
Ig strand B 228..232 CDD:409353 0/3 (0%)
Ig strand C 241..245 CDD:409353 1/3 (33%)
Ig strand E 264..268 CDD:409353 0/3 (0%)
Ig strand F 278..283 CDD:409353 3/4 (75%)
Ig strand G 291..294 CDD:409353 0/2 (0%)
Ig 300..414 CDD:472250 23/119 (19%)
Ig strand B 319..323 CDD:409353 1/3 (33%)
Ig strand C 332..336 CDD:409353 1/6 (17%)
Ig strand E 380..384 CDD:409353 2/3 (67%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
IG_like 426..505 CDD:214653 21/103 (20%)
Ig strand B 434..438 CDD:409353 1/7 (14%)
Ig strand C 448..452 CDD:409353 0/3 (0%)
Ig strand E 475..479 CDD:409353 1/7 (14%)
Ig strand F 489..494 CDD:409353 1/4 (25%)
FN3 513..606 CDD:238020 26/153 (17%)
fn3 642..712 CDD:394996 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.