DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrg and cntn2

DIOPT Version :9

Sequence 1:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster
Sequence 2:XP_031752703.1 Gene:cntn2 / 100487049 XenbaseID:XB-GENE-6070188 Length:1033 Species:Xenopus tropicalis


Alignment Length:1079 Identity:292/1079 - (27%)
Similarity:457/1079 - (42%) Gaps:135/1079 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILAALLVALLCAGSAES-KGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYS 70
            :|:::.::......||| .....|...:||.  ..||......::...|    |.|...|...|.
 Frog     9 LLSSVFLSFSALKPAESFMSEYGPVFEEQPE--NTLFPDGSIEEQVTLP----CRARASPSATYR 67

  Fly    71 WIKNGKKFDWQAYDNRMLRQPGRGTLVITIP-KDEDRGHYQCFASNEFGTATSNSVYVRKAELNA 134
            |..||.:.:..|  :...|..| |.|.|:.| :.:..|.|||.|||..||..|:...:|...|..
 Frog    68 WQLNGTELNLTA--DPSYRLVG-GNLAISGPTQSKHAGTYQCIASNPKGTVLSSEASLRFGYLQE 129

  Fly   135 FKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNV 199
            |..|...|::..||...||.|..|..:|..:..|::.|.  .:..:.:|.|......|||:.:..
 Frog   130 FPAEQRDTVKVTEGWGVMLACNPPKHYPGLSYRWLLNEF--PTFLNTDNRRFVSQVTGNLYVAQT 192

  Fly   200 TREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSR------RQSLA 258
            .:||..:   |:|..||......|   .|.....|:.|    |.....|.|...      .::.|
 Frog   193 VKEDEGA---YSCLTTSHISFTTK---SVYSSFTQLNV----NSEVKPRTYAPSIKVRFPGETYA 247

  Fly   259 LRGKRMELFCIYGGTPLPQTVWSK-DG---QRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDV 319
            |.|:.:.|.|...|.|:|...|.| ||   .|:...|.:        |......|::.|||.|:.
 Frog   248 LYGQAVFLECFAFGNPVPHIRWRKVDGTLPPRLLVIDPV--------LHFPSITFEEDGTYECEA 304

  Fly   320 SNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTP 384
            .|..|:......:: |.:.|.:........|....::::.|.|:|.|.|.|.|:.:|||:.... 
 Frog   305 VNSEGSTTHQGRVI-VQAQPEWLHVITDTEAKIGSDLLWSCAASGKPRPTIRWLRDGKPLMTQV- 367

  Fly   385 NPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPA--AVSTVDGR 447
              ...:|:..|:..:|...|:|.|.|.|.|..|.:|....|.|||..|....:|.  .:....|.
 Frog   368 --NIEITNGQIKFTSLSLHDSGMYQCVAENKHGTIYTTAELTVQALAPDFRLSPVKRLIPAARGG 430

  Fly   448 NVTIKCRVNGSPKPLVKWLRASNWL-TGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQA 511
            .|.|:|....:|.||:.|.:.:..| ...|..|.|||.|.:::::.||.|||||:|:|..|:..:
 Frog   431 EVIIQCNPRAAPTPLILWSKGTELLFNSSRVTVTANGTLILRNISRSDEGKYTCFAENIMGKSNS 495

  Fly   512 DGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLEIEIDWWKDGQSIDFEAQPRFVKTND 576
            .|.|.|:|.|:||..|...::..|.|.|.:|:.:||.::::...|..:|..||||.:.:..:...
 Frog   496 TGVLSVREATKITLAPSGSDINQGDSITLQCHASHDPSMDLTFTWTLNGIPIDFEKEAQNYRRTS 560

  Fly   577 -----NSLTIAKTMELDSGEYTCVARTRLDEATARANLIVQDVPNAP-----KLTGITCQADKAE 631
                 ..|.|.......:|:|||:|:|.:|..:|.|:|:::..|..|     |..|.|    ..:
 Frog   561 MDEAVGDLHIINAQLRHAGKYTCMAQTVVDRTSAMASLLIRGPPGPPGGVVVKYVGET----MVQ 621

  Fly   632 IHWEQQGDNRSPILHYTIQFNTSFTPASWDAAYEKVP----NTDSSFVVQMSPWANYTFRVIAFN 692
            :.|.:..||.|||..|.:|.....|.. |.:|....|    |.:|:.||.::.|.:|.||::|.|
 Frog   622 LSWSRGFDNHSPISRYVVQVREPLTEI-WRSARTDPPTVEGNAESALVVGLNQWTDYLFRIVASN 685

  Fly   693 KIGASPPSAHSDSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWKRDI 757
            .:|...|||.|....|:...|...|..|.|.|..||.|.|:|||:.....|..:|.|.:::||  
 Frog   686 ILGDGDPSAPSALIRTREAAPNVAPSEVGGGGGAPNELTINWTPIGRQYQNGDDFGYIIAFKR-- 748

  Fly   758 PAAAWENNNI-------------FDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVVGY 809
                 :|.|.             :.:|..:|.     .:..:.:|:...|.:||...:.:..| |
 Frog   749 -----KNENTWLTVRVPGGQSQQYVYRNESIA-----AYTPFDVKIQGYNKKGEGPFSRDTTV-Y 802

  Fly   810 SGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEESVRGHFKGYKIQTWTENEGEEGLREIHVKGD 874
            |.|:.|...|:......|:||.. .:||.||  ::::|...||:|:.|..::.|.....:...|.
 Frog   803 SAEEEPRMFPSEVKATAISSSDI-EVAWNPV--QTLKGVLLGYEIRYWKTSDKEAAADRVRSAGM 864

  Fly   875 THNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKK 939
            ...|.||..|||:..|..:..||....||.|...:..|.:...|.:.....:.|...:..:.|..
 Frog   865 ATTAHVTSLKPDTTYYVTVRVYNQAGTGPSSPATNVTTSKAPSSKLPENIKWTLSRKSLSIKWNP 929

  Fly   940 --PLYPNGKLTGYKIYYEEVKES----YVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITAT 998
              .|.....:|||||.|.....|    ||..:            |.:::...:..|...|.:.||
 Frog   930 VVALQNESSVTGYKILYRMSHHSTPILYVTSK------------THIELPFPEGFSTVTIQLRAT 982

  Fly   999 TKMGEGSEHYIEKTTLKDAVNVAPATPSFSWEQLPSDNG 1037
            .|.|:|.                ||.     ..:|:|:|
 Frog   983 GKGGDGE----------------PAE-----VHIPTDSG 1000

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrgNP_001245581.1 Ig 55..128 CDD:299845 24/73 (33%)
IG_like 57..127 CDD:214653 24/70 (34%)
Ig 135..214 CDD:299845 21/78 (27%)
IG_like 141..216 CDD:214653 19/74 (26%)
ig 251..332 CDD:278476 22/90 (24%)
I-set 339..427 CDD:254352 24/87 (28%)
Ig 354..427 CDD:299845 22/72 (31%)
I-set 432..517 CDD:254352 29/87 (33%)
Ig 446..517 CDD:299845 27/71 (38%)
I-set 522..611 CDD:254352 27/93 (29%)
ig 525..609 CDD:278476 24/88 (27%)
FN3 613..707 CDD:238020 32/102 (31%)
FN3 716..807 CDD:238020 24/103 (23%)
fn3 817..905 CDD:278470 26/87 (30%)
FN3 917..1004 CDD:238020 20/92 (22%)
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
cntn2XP_031752703.1 Ig 324..408 CDD:416386 23/86 (27%)
Ig strand A 324..327 CDD:409353 0/2 (0%)
Ig strand A' 331..335 CDD:409353 0/3 (0%)
Ig strand B 339..347 CDD:409353 1/7 (14%)
Ig strand C 353..358 CDD:409353 2/4 (50%)
Ig strand C' 360..363 CDD:409353 2/2 (100%)
Ig strand D 368..372 CDD:409353 0/3 (0%)
Ig strand E 374..379 CDD:409353 1/4 (25%)
Ig strand F 388..395 CDD:409353 3/6 (50%)
Ig strand G 399..408 CDD:409353 2/8 (25%)
Ig5_Contactin 413..501 CDD:409358 29/87 (33%)
Ig strand B 432..436 CDD:409358 2/3 (67%)
Ig strand C 445..449 CDD:409358 1/3 (33%)
Ig strand E 467..471 CDD:409358 2/3 (67%)
Ig strand F 481..486 CDD:409358 4/4 (100%)
Ig strand G 494..497 CDD:409358 0/2 (0%)
Ig 503..601 CDD:416386 29/97 (30%)
Ig strand A 503..509 CDD:409353 3/5 (60%)
Ig strand A' 512..517 CDD:409353 0/4 (0%)
Ig strand B 520..528 CDD:409353 3/7 (43%)
Ig strand C 537..541 CDD:409353 0/3 (0%)
Ig strand D 562..565 CDD:409353 0/2 (0%)
Ig strand E 566..570 CDD:409353 1/3 (33%)
Ig strand F 579..586 CDD:409353 4/6 (67%)
Ig strand G 593..597 CDD:409353 1/3 (33%)
FN3 615..696 CDD:238020 28/85 (33%)
FN3 709..802 CDD:238020 25/105 (24%)
FN3 812..902 CDD:238020 27/92 (29%)
FN3 911..997 CDD:238020 22/118 (19%)
Ig 30..126 CDD:416386 31/104 (30%)
Ig strand A 33..37 CDD:409353 0/3 (0%)
Ig strand A' 40..45 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 2/11 (18%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
Ig strand C' 72..75 CDD:409353 1/2 (50%)
Ig strand D 82..86 CDD:409353 1/3 (33%)
Ig strand E 88..94 CDD:409353 3/5 (60%)
Ig strand F 101..110 CDD:409353 5/8 (63%)
Ig strand G 113..126 CDD:409353 4/12 (33%)
Ig 134..223 CDD:416386 24/96 (25%)
Ig strand A 136..141 CDD:409353 1/4 (25%)
Ig strand B 145..151 CDD:409353 2/5 (40%)
Ig strand C 159..165 CDD:409353 1/5 (20%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand D 177..182 CDD:409353 1/4 (25%)
Ig strand E 185..189 CDD:409353 3/3 (100%)
Ig strand F 199..207 CDD:409353 3/10 (30%)
Ig strand G 209..223 CDD:409353 3/16 (19%)
Ig 235..320 CDD:416386 22/93 (24%)
Ig strand A 235..240 CDD:409353 0/4 (0%)
Ig strand A' 243..248 CDD:409353 0/4 (0%)
Ig strand B 251..260 CDD:409353 2/8 (25%)
Ig strand C 266..270 CDD:409353 0/3 (0%)
Ig strand C' 273..275 CDD:409353 1/1 (100%)
Ig strand D 281..284 CDD:409353 0/2 (0%)
Ig strand E 285..290 CDD:409353 1/12 (8%)
Ig strand F 298..306 CDD:409353 4/7 (57%)
Ig strand G 309..320 CDD:409353 1/11 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.