DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32214 and CG13069

DIOPT Version :10

Sequence 1:NP_730409.2 Gene:CG32214 / 317919 FlyBaseID:FBgn0052214 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster


Alignment Length:110 Identity:50/110 - (45%)
Similarity:67/110 - (60%) Gaps:22/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFK-YAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGIA 64
            ||| :||.:.||:||.|||||:: |||||:|||..:||||.              |.:|.|:|..
  Fly     1 MFKFFAVALFALIACVAAKPGIV-APLAYSAPLVAAAPAAA--------------VYSREYHGNF 50

  Fly    65 AAPVIAP--VAAP-LAAPVVAK-YAATPLAAPLAYSSPLAYSAPL 105
            |||.:|.  ||:| :|:|.||. |.|:|..|....::|  |:|||
  Fly    51 AAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAP--YTAPL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32214NP_730409.2 None
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 16/41 (39%)

Return to query results.
Submit another query.