DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32214 and CG18294

DIOPT Version :9

Sequence 1:NP_001262045.1 Gene:CG32214 / 317919 FlyBaseID:FBgn0052214 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster


Alignment Length:141 Identity:101/141 - (71%)
Similarity:110/141 - (78%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYT------APLAYSAPAAVVAAPAPVVTATSSQVIARN 59
            |||.|||:||:||||||||||||||||||      ||||||||||||||||||||||||||||||
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIARN 65

  Fly    60 YNGIAAAPVIAPV---------AAPLAAPVVAKYAATPL---------AAPLAYSSPLAYSAPLS 106
            |||||||||||||         ||||||||||||||.||         |||||:.|.|||::||:
  Fly    66 YNGIAAAPVIAPVAAPVVAKYAAAPLAAPVVAKYAAAPLAAPVVAKYAAAPLAHISSLAYTSPLA 130

  Fly   107 YAA-ASGPLLI 116
            |:| .|.|:|:
  Fly   131 YSALPSAPVLL 141



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448861
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25851
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.