DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32213 and CG32212

DIOPT Version :9

Sequence 1:NP_730413.2 Gene:CG32213 / 317918 FlyBaseID:FBgn0052213 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_730416.1 Gene:CG32212 / 317917 FlyBaseID:FBgn0052212 Length:111 Species:Drosophila melanogaster


Alignment Length:135 Identity:79/135 - (58%)
Similarity:84/135 - (62%) Gaps:30/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAP------AAVVAAPAPVVTATSSQVIARN 59
            ||||||:||..||||||||.||||.||||.|||||||      ||||.||.|.|||||   ||||
  Fly     1 MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAPTPPVTATS---IARN 62

  Fly    60 YNGIASAPVIAPVAAPLAAPVVAKYAATPLAAPVVAKYAATPLAARLAYSSPLAYSAPLSYAAAP 124
            .|||.:|..||.|                 |||||||||    ||.|||.|.||.|||:|.|:|.
  Fly    63 NNGIDAASEIASV-----------------AAPVVAKYA----AASLAYPSRLANSAPISCASAA 106

  Fly   125 APFLI 129
            |..:|
  Fly   107 AQVII 111



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I15489
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I7469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.