| Sequence 1: | NP_730416.1 | Gene: | CG32212 / 317917 | FlyBaseID: | FBgn0052212 | Length: | 111 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_730410.2 | Gene: | 825-Oak / 317916 | FlyBaseID: | FBgn0052208 | Length: | 129 | Species: | Drosophila melanogaster |
| Alignment Length: | 135 | Identity: | 80/135 - (59%) |
|---|---|---|---|
| Similarity: | 84/135 - (62%) | Gaps: | 30/135 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAPTPPVTATS---IARN 62
Fly 63 NNGIDAASEIASV-----------------AAPVVAKYA----AASLAYPSRLANSAPISCASAA 106
Fly 107 AQVII 111 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I15489 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 79 | 1.000 | Inparanoid score | I7469 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005927 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.060 | |||||