DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 825-Oak and CG13068

DIOPT Version :9

Sequence 1:NP_730410.2 Gene:825-Oak / 317916 FlyBaseID:FBgn0052208 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_648856.1 Gene:CG13068 / 39784 FlyBaseID:FBgn0036588 Length:109 Species:Drosophila melanogaster


Alignment Length:125 Identity:59/125 - (47%)
Similarity:71/125 - (56%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYA--VVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTATSSQVIARNYNGI 63
            |||.:  ||:.|||||::|:|          .|...:|...|.||||.||||||||.:|||:||:
  Fly     1 MFKLSALVVLCALVACSSAEP----------KPAILAAAPVVAAAPAGVVTATSSQYVARNFNGV 55

  Fly    64 AAAPVI-----APVAAPLAAPVVAKYAATPLAAPVVAKYAATPLAARLAYSSPLAYSAPL 118
            |||||:     ||||   ||...|..||....|||.|.|:|.|.|   ||....||:..|
  Fly    56 AAAPVVAAAYTAPVA---AAAYTAPVAAAAYTAPVAAAYSAYPYA---AYPYSAAYTTVL 109



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.