DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SRP3

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:370 Identity:70/370 - (18%)
Similarity:140/370 - (37%) Gaps:69/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSKGRLARNFVYSPIAIRQALGLLYLSK-DNVTDQQLESALQLTGLNQEEIISLFKEA------- 86
            ||......|.::||.:|..|:.:..... .::...|:.|.|:.:.:  :|:.::|:|.       
plant    22 LSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSI--DELKTVFRELASVVYAD 84

  Fly    87 REKVAQEQFTMGNRIYLSPDYNASPNITQLSENLGVEVKNMTFSGD-QSAASEIKKWLNKWIGKA 150
            |......:.|..|.:::.......|....|.||.   .|.:....| :|.|.|::|.:|.|:...
plant    85 RSATGGPKITAANGLWIDKSLPTDPKFKDLFENF---FKAVYVPVDFRSEAEEVRKEVNSWVEHH 146

  Fly   151 GGN----LFGKNDISQTTQIVAVQGMSYSCVWK---------NRETALTNRTFTLLRQNKKPFVY 202
            ..|    |.....::..|..:....:|:...||         :.:..|.|.|...:     ||:.
plant   147 TNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSV-----PFMS 206

  Fly   203 TTQMMYTEAPMDFFNNDQVRGVMVPFK------NSDMGMLVLLPRPRYSTQQILYS-------LD 254
            :.:..|..|      .|..:.:.:|::      |....|...||..:.....:|..       ||
plant   207 SYENQYVRA------YDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLLEKMASTPGFLD 265

  Fly   255 TILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNAANFKQYNSFDADQNRVLMT 319
            :  .|...|.:.....:||||:.....:...|..||::::     :...|.....|.:.......
plant   266 S--HIPTYRDELEKFRIPKFKIEFGFSVTSVLDRLGLRSM-----SMYHKACVEIDEEGAEAAAA 323

  Fly   320 IDVGD-----DFDD---RVVYV-NRGFVFVVKDK--STIYMIGRM 353
            ...||     ||.:   ::.:| :..|:|:::::  .|:..:|::
plant   324 TADGDCGCSLDFVEPPKKIDFVADHPFLFLIREEKTGTVLFVGQI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 70/368 (19%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 70/370 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.