DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and AT3G45220

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:314 Identity:62/314 - (19%)
Similarity:121/314 - (38%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIFLLKHSYAYNFEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGL 74
            ::.|.||         :...::.|   .|.|:||::|...|.|:....:.||.:|:.|.:.|.  
plant    14 MVLLAKH---------VIPTVANG---SNLVFSPMSINVLLCLIAAGSNCVTKEQILSFIMLP-- 64

  Fly    75 NQEEIISLFKEAREKVAQEQFTMGNRIYLSPDYNA--------SPNITQLSEN-LGVEVKNMTFS 130
             ..:.::........||.......:.::||..|..        .|:...|.|| .......:.|:
plant    65 -SSDYLNAVLAKTVSVALNDGMERSDLHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDFA 128

  Fly   131 GDQSAASEIKKWLNKWIGKAGGNLFGK---NDISQT---TQIVAVQGMSYSCVWKNRETALTNRT 189
               :..:|:...:|.|.......|..:   :|..:|   :.::....:.:...|..:..|...::
plant   129 ---TKPAEVINEVNAWAEVHTNGLIKEILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKS 190

  Fly   190 --FTLL--RQNKKPFVYTTQMMYTEAPMDFFNNDQVRGVMVPF--KNSDMGMLVLLPRPRYSTQQ 248
              |.||  ...|.||:...:..|    :::::..:|  :.:|:  ......|.:.||..|.....
plant   191 YDFHLLDGTMVKVPFMTNYKKQY----LEYYDGFKV--LRLPYVEDQRQFAMYIYLPNDRDGLPT 249

  Fly   249 ILYSLDT---ILKIKLRRSK-KTHLF-LPKFKVSESVDLNMALKALGIQNLFTN 297
            :|..:.:   .|...:.|.: .|..| :||||.|.....:..||.:|:...||:
plant   250 LLEEISSKPRFLDNHIPRQRILTEAFKIPKFKFSFEFKASDVLKEMGLTLPFTH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 59/303 (19%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 62/314 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.