DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn75F and SRP2

DIOPT Version :9

Sequence 1:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_179060.1 Gene:SRP2 / 815941 AraportID:AT2G14540 Length:407 Species:Arabidopsis thaliana


Alignment Length:297 Identity:64/297 - (21%)
Similarity:121/297 - (40%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NFVYSPIAIRQALGLLYLSKDNVTDQQLESALQ--LTGLNQEEIISLFKEAREKVAQEQFTMG-- 98
            |.|:||.:|...|.:...:.||.|   |.|.:.  |...:.||..::|.|....|.::....|  
plant    58 NCVFSPASINAVLTVTAANTDNKT---LRSFILSFLKSSSTEETNAIFHELASVVFKDGSETGGP 119

  Fly    99 -----NRIYLSPDYNASPNITQLSENLGVEVKNMTFS--GDQSAASEIKKWLNKWIGKAGGNL-- 154
                 |.:::....:.:|:    .|:|.:.....:|:  ..:..|.|::..:|.|..:...:|  
plant   120 KIAAVNGVWMEQSLSCNPD----WEDLFLNFFKASFAKVDFRHKAEEVRLDVNTWASRHTNDLIK 180

  Fly   155 --FGKNDISQTTQIVAVQGMSYSCVW-KNRETALT-NRTFTLLRQNKK----PFVYTTQMMYTEA 211
              ..:..::..|..:....:.:...| |..:.::| ::.|.||  |.|    ||:.:.:..:.||
plant   181 EILPRGSVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLL--NGKSVSVPFMRSYEKQFIEA 243

  Fly   212 PMDFFNNDQVRGVMVPFK------NSDMGMLVLLPRPRYSTQQILYS-------LDTILKIKLRR 263
                  .|..:.:.:|::      |.:..|.:.||..:.....:|..       ||:  .|...|
plant   244 ------YDGFKVLRLPYRQGRDDTNREFSMYLYLPDKKGELDNLLERITSNPGFLDS--HIPEYR 300

  Fly   264 SKKTHLFLPKFKV-----SESV----DLNMAL--KAL 289
            .......:||||:     :.||    :||::|  |||
plant   301 VDVGDFRIPKFKIEFGFEASSVFNDFELNVSLHQKAL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 64/297 (22%)
SRP2NP_179060.1 SERPIN 36..397 CDD:294093 64/297 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.